SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008311 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008311
Domain Number 1 Region: 89-176
Classification Level Classification E-value
Superfamily SAND domain-like 7.67e-30
Family SAND domain 0.0000102
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008311
Domain Number - Region: 248-344
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0705
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008311   Gene: ENSMPUG00000008374   Transcript: ENSMPUT00000008444
Sequence length 536
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896972.1:8406596:8429293:-1 gene:ENSMPUG00000008374 transcript:ENSMPUT00000008444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDSAVDGSSVEEVKTVLVTTNLAPHGAELAEDSMETENAAAA
AAAAFTASSQLKEAVLVKVAEEEERLEAEIVYPITCGGSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSPTSAEYIPLTPATADVNGSPATITIETCEDPSDWTTAIGDDTFSFWRGL
KDAGLLDEVIQEFHQELMETMKGLQQRVQDPPLQLRDAVLLNNIVQNFGLLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPTKRPR
LARATSGPAAVASQVLSQSAQIALSPGVPVSQLTGVPLGKVVSALPSPVLGKAPPQAAPA
SSPASPLLGGYTVLASSGTAFPGAVEIHPDASSLTVLSTAAMQDGSTVVKVVSPLQLLTL
PGLGPALQNVAQVSPGGSTIVTVPTGAVESAVAASGPEEHTATIEVAAMAEGPEHK
Download sequence
Identical sequences M3YAF4
XP_004760094.1.14098 XP_004760095.1.14098 XP_012915614.1.14098 ENSMPUP00000008311 ENSMPUP00000008311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]