SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008313 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008313
Domain Number 1 Region: 33-320
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-92
Family Nuclear receptor ligand-binding domain 0.000000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008313   Gene: ENSMPUG00000008376   Transcript: ENSMPUT00000008446
Sequence length 324
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897073.1:1210300:1235417:-1 gene:ENSMPUG00000008376 transcript:ENSMPUT00000008446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMSDAAVEQRRALIRRKKRERMGTQTLGAKGLTQEQQTMIRELMDAQMKTFDTTFSNFK
DFRLPEAPSSGHEVPESLQPPAGEEAAKWSQIREDLCSLKVTLCLRGEDGSVWNYKPQPD
SSGREIFSLLPHMADMSTYMFKGIINFAKVISHFRDLPIEDQISLLKGATFELCQLRFNT
VFNAETGTWECGRLSYCLEDPAGGFQQLLLEPVLKFHYRLKKLQLHREEYVLMQAISLFS
PDRPGVVQRSVVDQLQERFAIALKAYIECSRPQPAHRFLFLKIMAILTELRSINAQHTQR
LLRIQDIHPFASPLMRELFGITDG
Download sequence
Identical sequences M3YAF6
ENSMPUP00000008313 ENSMPUP00000008313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]