SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008316 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008316
Domain Number 1 Region: 867-1162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.11e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000132
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-34
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-29
Family Second domain of FERM 0.00039
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-17
Family First domain of FERM 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008316   Gene: ENSMPUG00000008379   Transcript: ENSMPUT00000008449
Sequence length 1166
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:26262680:26328616:1 gene:ENSMPUG00000008379 transcript:ENSMPUT00000008449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYHNKQNQRRWVDLEKPLKKQLDKHAIEPTVYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVALLHQKYRRLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDICIGACLEG
IFVKHKNGRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRLCVAR
HKFYRLNQCSLQTQTVTVNPIRRRSSSRVSLPKPQPYVMPPPPQRHYNGHYTEPYTSSQD
NLFATNQNGYYCHSLTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPS
ITGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLNRGMVHAERQSHSLRNLNIGSS
YAYSRPDALVYSQPEIREHAHFASPQSAHYPFSLNYSFHSPSPYPHPAERRPVVGAVSVP
ELTNVQLQAQDYPAPNIMRTQVYRPPPPYPPPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEASLPVAHSLQEVSEPLTAARRAHLHKRNSIEVAGLAHSLEGLRLKERTLSAS
AADPPPRPVSAGSQHGGCPDRAERRPADERGGLGYGHKKSLSDATMLIHSSEDEEDLDEE
MASLAVPFPHARVPRGHHSPELPPGPSRGPCALTPSAPGPGPMHGREPVPQLGEAGGPRR
EGLLTPSMSESDLTTSGRYRARRDSLKQRPVSDLLSGKKNVVEGLPPLGGMKKSRVDAKK
IGPLKLAALNGLSLSRLPLPDEGKEVPARATNDERCKILEQRLEQGMVFTEYEKILKKRL
VDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSVSGIEWDYI
ATQGPLQNTCQDFWQMVWEQGVAIIAMVTVEEEGGREKSFRYWPRLGSRHNTVTYGRFKI
TTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDIKGFLSYLEEIQSVR
RHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRGLDMLRQQRM
MMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences M3YAF9
ENSMPUP00000008316 XP_004739159.1.14098 XP_004739160.1.14098 ENSMPUP00000008316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]