SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008319 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008319
Domain Number 1 Region: 523-607
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-21
Family PDZ domain 0.0059
Further Details:      
 
Domain Number 2 Region: 10-84
Classification Level Classification E-value
Superfamily HR1 repeat 1.31e-18
Family HR1 repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008319   Gene: ENSMPUG00000008382   Transcript: ENSMPUT00000008452
Sequence length 695
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897203.1:1183251:1192407:-1 gene:ENSMPUG00000008382 transcript:ENSMPUT00000008452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQVGRPPGAFKGSDPLAQSPHGRPQSRRARVRQQITKELRMRTGAENLYRATSNAWVRE
TVALELSYVNSSLQLLKEELHELSGGRVEADRPEGEGITVPMIPLGLKETKELDWSTPLK
ELISGHFGEDSASYEAEIRELEDLRQAARTPSQSEAGLGPLMAYYNQLCFLDARFVAPPG
NLGLHFHWYDSLTGVPAQQRALAFEKASVLFNIGALHTQIGARQDRSCLEGTHHAIEAFQ
RAAGAFSLLRENFSRAPSPDMSPASLSMLERLMTAQAQECVFEGLLLSSPEGPQDCLAQL
RLAQEAAQVAAEYRQVHQTMAQPPVRDYVPFPWTTLAHVKEEYFRALAHYHAAMALCDSP
RECPARPSLPLQGPSWRGSRPALAPAAAEVDFPMRQQALRGHPAASEPEPWGTGLPQKPE
ERRKLGKAHLKRSILGQEEALRLHAVGRALRTVDLLQAVLTQALRRSLAKYSELDLEDDF
LETTEAPDIQPKTQQKPEIRAPSFSRVKVTDIFQRLGPLSVFSARNRWRLVGPVHVTRGE
AGFGLTLRGDAPVLIAAVIPGGPAAAAGLHEGDYIVSLNGQPCKWWRHAEVVAQLRGVGD
EGVSLQVATLLPRAEPPGTQGHHRPALGALLRSQKECDWGAPTPARAGLRPFLGRSRNAR
RSQPHGGCPGLRALRPACSPRTTPSPPSSIHPGGA
Download sequence
Identical sequences M3YAG2
ENSMPUP00000008319 ENSMPUP00000008319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]