SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008341 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008341
Domain Number 1 Region: 312-662
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.79e-129
Family Mammalian PLC 0.0000000000166
Further Details:      
 
Domain Number 2 Region: 877-937,977-1153
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 7.59e-66
Family C-terminal domain of PLC-beta 0.0000005
Further Details:      
 
Domain Number 3 Region: 143-308
Classification Level Classification E-value
Superfamily EF-hand 7.89e-50
Family EF-hand modules in multidomain proteins 0.000000042
Further Details:      
 
Domain Number 4 Region: 11-141
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-43
Family Pleckstrin-homology domain (PH domain) 0.00000016
Further Details:      
 
Domain Number 5 Region: 682-799
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.37e-23
Family PLC-like (P variant) 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008341   Gene: ENSMPUG00000008404   Transcript: ENSMPUT00000008475
Sequence length 1187
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:7167682:7190746:-1 gene:ENSMPUG00000008404 transcript:ENSMPUT00000008475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITNIRDTRFGKFAKIPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKSWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPLARPDQVRGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRMTFGEMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKNQFSVPATPSKEPGGS
AENNCPPRASVGEDPVWAGEDGAEPEEEEVEEEEEESGNLDEEELKKMQSDEGTAGLEVT
AYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMS
RIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFM
RRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSDRSVRTYVEVELFGLPGDPKRRYRTK
LSPTANSINPVWKEEPFVFEKILMPELASLRVAVLEEGNKFLGHRIIPINALNSGYHHLC
LHSESNLPLTMPALFVFLELKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAMEGLP
EKPFPLGSPIVRPVNGALAPTSNGSAAAGARAKEEAMKEATEPQTASPEELRELKGVLKL
QRRHEKELRDLERRGARRWEELLQRGAAELAGLGQPSAGGCGGRRLGPGKGSRKKRTLQC
EEAAGPAPGEGREGSEGADARARELQDRLELELLQQGEEQYECILKRKEQHVAEQIAKMM
ELAREKQAAELKTLKETLEIDTKEMKKKLEAKRLERIQAMVKVTPDKMAQERLKREINNS
HIQEVVQVIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQQEVLAEYEVRMKGLEAEV
KESVKACLRNCLPSEAKDKPERPYEAFRELCDQDPLTAKAGAEESRL
Download sequence
Identical sequences M3YAI4
ENSMPUP00000008341 XP_004751148.1.14098 ENSMPUP00000008341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]