SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008353 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008353
Domain Number 1 Region: 18-187
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-40
Family RUN domain 0.0009
Further Details:      
 
Domain Number 2 Region: 536-649
Classification Level Classification E-value
Superfamily PH domain-like 5.79e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 692-793
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000126
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008353   Gene: ENSMPUG00000008417   Transcript: ENSMPUT00000008488
Sequence length 1065
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:1243071:1287253:1 gene:ENSMPUG00000008417 transcript:ENSMPUT00000008488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVVENGLDPRAAIPVIKKKLVGSVKALQKQYVSSDTAVTSEDGDANAMCSALEAVFIH
GLHAKHIRVEAGGKRKKSAHQKPLPQPVFWPLLKAVTHKHIISELEHLIFVSTDVGRCRA
WLRLALNDGLMECYLKLLLQEPAHLCEYYQPTALLRDAEEGEFLLSFLQGLTSLSFELSY
KSAILNEWTLTPLALSGLCPLSDLDPLTTSGTELQRKESLDSISHSSGSEDIEVQHSGHK
IRRNRKLTASSLSLDTASSSQLSCSLNSDSCLLQENGSKSPERSEEPMSYDSDVGTANAE
DSDLSLQEVLSEFSKAQVNSVPTNGLGGLGGEAEIPTGRASLSFPGPEASIPSDGPTEPL
PAQASPVALDGHHKQQPPACASGALGLPLLGTAQAVPLGSALGQQPGSPMRVPAQALAQG
SGQQKPPEDDGAAWSLGVSSPTSPKSKSWISEDDFYRPPQEPPPESPSERSVASSGGTPE
LRPSLLRHFSQGPRKSFSTGALDKACVPSPGSRKSRTAVAQEHKNFRVVHRRQMGLSNPF
RGLMKLGTVERRGAMGIWKELFCELSPLEFRLYLNTEERLCVETCSLLRCESVGPAHSDG
RFELVFSGRKLALRASSQDEAEDWLDRVREALQKCRPQQEDEWVNIQYPEPPEDPPGAPQ
SGLPSHPDLLPEPETLQATQFCWSSAQDPEPDAIKESLLYLYTDRTWMPYIFSLSLESLK
CFRVRNNEKMLSDSHGIETIRDILPDTSLGGPSFFKIITAKAVLKLQAGSAEEAALWRDL
VRKVLASYLETAEEAVTLGGSLDENCQEVLKFATRENGFLLQYLVAIPTEKGLDSQGCFC
AGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARIIHNWDLTKRPICRQALRFLT
QIRAQPLINLQLVNASLYEHVEQMRLVRSCREQLKLLGDYLGLCRSGALKELSKRLNHRN
YLLESPHKYSVADLQQIADGVYTGFLNALIGFASQHVYHCDLCTQRGFICQICHHHDIIF
PFEFDTTVRCSECKTVFHQSCEAVVRKGCPRCARRRKYQEQNALT
Download sequence
Identical sequences M3YAJ6
XP_004772520.1.14098 ENSMPUP00000008353 ENSMPUP00000008353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]