SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008386 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008386
Domain Number 1 Region: 247-340
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.74e-20
Family Starch-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008386   Gene: ENSMPUG00000008450   Transcript: ENSMPUT00000008521
Sequence length 344
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897018.1:851517:856186:-1 gene:ENSMPUG00000008450 transcript:ENSMPUT00000008521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVWSALLVGGGLAGAIFVWLLRDADKEQKDAPPGGAAAPGADPGGAGALSPGPSGREL
VAKPEHLQESNGCLVSETKGHGNLQQAARRLQSSSGKDSDCDHSREHVPSGRFPDPESLA
ASETGNSQGYSKVSRNESPESSGGGWGFQKGRETLAKVASCLAEKLYSSNQVIDRAKEVS
LAQQGNQDRADEDWEMVSRHSSWGDVSLSGSLEAPGLSPNQGMDCGQIRGQEVYVRRQKA
GAASSGSPRVRVHFQVHYVPSAGSQLVAVTGDHESLGRWKSYIALQRSKDGFWFRSVPLP
ADTVVAWKFVVVDHGEITRWEECSNRSLDTGREDKVVQKWWGIP
Download sequence
Identical sequences M3YAM9
ENSMPUP00000008386 XP_004766298.1.14098 ENSMPUP00000008386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]