SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008387 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008387
Domain Number 1 Region: 851-1176
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-103
Family Ras GEF 0.0000141
Further Details:      
 
Domain Number 2 Region: 160-383
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-43
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 3 Region: 371-526
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000042
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008387
Domain Number - Region: 4-79
Classification Level Classification E-value
Superfamily PH domain-like 0.000152
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008387   Gene: ENSMPUG00000008451   Transcript: ENSMPUT00000008522
Sequence length 1179
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896967.1:8755818:9004483:-1 gene:ENSMPUG00000008451 transcript:ENSMPUT00000008522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLLEGCSCERTPAPPRAGVGPGAARDALDKQYYFTVLFGHEGQKPLELRCEEEQDGKEW
MEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEIVA
LNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKR
NQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
IMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLIEEPDASDDDSKGSG
QVFGHLDFKIVVEPPDSAPFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVFEENS
KVTVPHMIKSCLLIHSLEKCFSYSYICFHSGQKPIRRYFKHYKVLQNNEDITFHTICGLN
CTNKTDRLKLINEPGRMKRTVELFKEPALKIYFRSLELFFATSQNNRGEHLVDGKSPRLC
RKFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTTTHSPAASPPPH
PGKVPLDLSRGLPSPEQSPGSIEESLDNPRMDLCNKLKRSIQRAVLESAPVDRAGVESSP
VADSTDLSPCRSPSTPQHLRYRQPVELGQTADNSLCSVSPASAFAIATAAAGHGSPPGFN
NTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLP
QERKATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIVF
RSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWV
AVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKN
LRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQT
CYRIDHQPKVTQYLLDKALIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences M3YAN0
ENSMPUP00000008387 ENSMPUP00000008387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]