SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008418 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008418
Domain Number 1 Region: 275-413
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-30
Family Phosphotyrosine-binding domain (PTB) 0.0000947
Further Details:      
 
Domain Number 2 Region: 111-258
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-30
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 
Domain Number 3 Region: 31-55
Classification Level Classification E-value
Superfamily WW domain 0.000000000386
Family WW domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008418   Gene: ENSMPUG00000008482   Transcript: ENSMPUT00000008553
Sequence length 486
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:14070892:14076184:1 gene:ENSMPUG00000008482 transcript:ENSMPUT00000008553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGKDYMLAIILVNCDDDLWGDQSLEGEPGLPPGWRKIRDAAGTYYWHVPSGSTQWQRPT
WETGDGEDPGTRTEGIWGLRPPKGRSFSSLESSLDRRNSLSWYGEESYIQSMEPGAKCFA
VHSLGWVEVPEEDLVPGKSSIAVNNCIQQLAQTRSRSRSQPPDGAWGEGQNMLMILKKDA
MSLVNPLDHSLIHCQPLVHIRVWGVGSSKGRDFAFVAGDKDSCMLKCHVFRCDVPAKAIA
SALHGLCAQILSERVGVNGDSPCSSLDPISPEDLPRQVELLDAVSQAAQKYEALYMGTLP
VNKAMGMDVLNEAIGTLTTRGDQDSWVPAMLSVSDSLMTAHRIQAEAGAEEEPLWQCPVR
LVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAVQAACMVQYQKCLVASAA
RGKAWGAQARARLRLKRTSSVDSPGGPLPLPLLKGGVGGTGAAPRKRGVFSFLDAFRLKP
SLLHMP
Download sequence
Identical sequences M3YAR1
XP_004744854.1.14098 ENSMPUP00000008418 ENSMPUP00000008418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]