SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008441 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008441
Domain Number 1 Region: 1-142
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-45
Family Phosphotyrosine-binding domain (PTB) 0.000000757
Further Details:      
 
Domain Number 2 Region: 307-417
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-27
Family SH2 domain 0.0000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008441   Gene: ENSMPUG00000008506   Transcript: ENSMPUT00000008577
Sequence length 425
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897185.1:921171:980171:1 gene:ENSMPUG00000008506 transcript:ENSMPUT00000008577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLDFSTRTQITREAISRVCEAVPGAKGAFRKRKPPSKMLSSILGKTNLQFAGMSISLT
VSTASLNLRTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDG
LAQDVIGSIGQAFELRFKQYLQCPSKVPAFHGRMQSLDEPWTEEEGDGLDHPYYNNIPSK
TPPPGGFADVRLQARPHGPDTAQFAGKEQTYYQGRHLGDPFGEDWQQTPVRQGSLDIYGM
PEGKAHAAPGEAPTYVNAQHLPPQATPASGSSAESSPRKDLFDMKPFEDALRNQSLGPVL
SKAASVECISPVTPRAPDAKMLEELEGEPWYRGETSRKEAEGLLKNDGDFLVRKSATNPG
SFVLTGMHNGQAKHLLLVDPEGTIRTKDKVFDSISHLINHHLENSLPIVSAGSELCLQQP
VEKAP
Download sequence
Identical sequences M3YAT4
ENSMPUP00000008441 ENSMPUP00000008441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]