SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008448 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008448
Domain Number 1 Region: 1-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.64e-173
Family Motor proteins 0.0000000234
Further Details:      
 
Domain Number 2 Region: 1699-1815
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-23
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 995-1098
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.6e-21
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 1816-1906
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-20
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 1599-1707
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.04e-16
Family First domain of FERM 0.088
Further Details:      
 
Domain Number 6 Region: 1090-1184
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000183
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 7 Region: 1311-1380
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000146
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008448
Domain Number - Region: 539-606
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000956
Family Motor proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008448   Gene: ENSMPUG00000008513   Transcript: ENSMPUT00000008584
Sequence length 1920
Comment pep:novel scaffold:MusPutFur1.0:GL897030.1:40785:90188:-1 gene:ENSMPUG00000008513 transcript:ENSMPUT00000008584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEGMSADQKKKLGLGQATDYNYLAMGNCTTCEGREDSQEYANIRSAMKVLMFTDTENWE
ISKLLATILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEVNPPALMNCLTSRTLIT
RGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKPPSQEVKSSRRSIGLLD
IFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLESIDWLHIEFTDNQDALD
MIANKPMNIISLIDEESKFPKGTDTTMLHKLNSQHKLNSNYIPPKNNHETQFGINHFAGV
VYYESQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGAETRKRSPTLSSQFKRS
LELLMRTLGACQPFFVRCIKPNEFKKPMLFDRLLCVRQLRYSGMMETIRIRRAGYPIRYS
FVEFVERYRVLLPGVKPAYKQDDLRGTCQRMAEAVLGTHDDWQIGKTKIFLKDHHDMLLE
VERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGHNCRRNYELMRLGFLRL
QALHRSRRLHQQYRLARQRIIKFQARCRAYLVRKAFRHRLWAVLTVQAYARGLIARRLHR
RLRAEYLRRLEAEKMRLAEEEKLRKEMSAKRAKEEAERKHQARLAQLAREDAERELKEKE
EARRKKELLEQMERARHEPINHSDMVDKMFGFLGTSGGLPGQEGQAPSGFEDLEHGRREM
VEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHTYTRRPLKQPLLFHDDEGDQLA
ALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQALQGEGETQ
LPEGQKKSSMRHKLVHLTLKKKSKLTEEVTKRLHDGESTAHGNSMLEDRPTSNLEKLHFI
IGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFVKYLRNFIH
GGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTTKTLLTDSA
TTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQYAKEQGAQE
RNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLAELASQQYF
VDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRTDAQKVKED
VVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLLELSFPEIM
AVSSSRGAKLVAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNP
NPAGEESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTL
PPREIVALVTMTPDQRQDVIRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMV
SKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFIAVLKYMGDYPSKRTRSVNEL
TDQIFEGALKAEPLKDEVYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQ
RFLQSRKHGPLALDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEA
FEVESSTKAKDFCQNIAARLLLKSSEGFSLFVKIADKVISVPENDFFFDFVRHLTDWIKK
ARPVKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVL
QLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQISPDDWKRSIVAYFNKHAGKSKEE
AKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGISLIDPRTKDILTTHPFT
KISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences M3YAU1
ENSMPUP00000008448 ENSMPUP00000008448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]