SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008484 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008484
Domain Number 1 Region: 5-346
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.08e-118
Family Calpain large subunit, catalytic domain (domain II) 0.000000105
Further Details:      
 
Domain Number 2 Region: 354-498
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.83e-37
Family Calpain large subunit, middle domain (domain III) 0.00014
Further Details:      
 
Domain Number 3 Region: 520-616
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.08e-16
Family Synaptotagmin-like (S variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008484   Gene: ENSMPUG00000008549   Transcript: ENSMPUT00000008620
Sequence length 640
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:129893:183400:-1 gene:ENSMPUG00000008549 transcript:ENSMPUT00000008620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSCVKPYEDQNYSALKRACLRRKVLFEDPNFPATDDSLYYQGSPGPTVRWKRPKDICEN
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGI
FHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSSSRNEFWCALVEKAYAKLAGCYQALDGG
NTADALVDFTGGVSEPIDLTEGGFAHDEAKRNQLFERVLKVHSRGGLISASIKAVTAADM
EARLACGLVKGHAYAITDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
EWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLINTSYLSVHKTWEEARLR
GAWTRHEDPQKNRSGGCINHKNTFFQNPQYIFDVKKPEDEVLICIQQRPKQSTRRDGKGE
NLAIGFDIYKVEENRQYRMHSLQHRAASSIYINSRSVFLRTDQPEGRFVIIPTTFEPGHT
GEFLLRVFTDVPSNCQELRLDEPPRSCWSSLCGYPQQVTQVHVLGAAGLKDSSTGANSYV
IIKCEGDKVRSAVQKGTSTPEYDVKGIFYRKKPGQPITVQIWNHRVLKDEFLGQVQLKAD
PDDLQALHTLHLRDRNSRQPSDLPGTVAVRVFSSTSLMAV
Download sequence
Identical sequences M3YAX7
XP_004768040.1.14098 XP_004768041.1.14098 XP_004768042.1.14098 ENSMPUP00000008484 ENSMPUP00000008484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]