SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008518 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008518
Domain Number 1 Region: 24-266,303-381,535-577
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-64
Family FAD-linked reductases, N-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.97e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008518   Gene: ENSMPUG00000008586   Transcript: ENSMPUT00000008657
Sequence length 585
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897073.1:2321681:2334423:-1 gene:ENSMPUG00000008586 transcript:ENSMPUT00000008657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAAKALLEQGFTDVTVLEASSCI
GGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGRRIPKDVVEEFSDLYNEVYNLTQEFFRHGKPVNAESQNSVGVFTREEVRNRI
RDDPEDPEATKRLKLAMIQQYLKVESCESGSHSMDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAKGIPAHVIQLGKPVRCVHWDQASARPRGPEIEPRGEGDHNHDAGEGGQGGEQP
RGDGRDEDKQWPVLVECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPGLPAEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESRTLTYLPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMEKCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAQGNSSKQQPGHLLSSKCSEQSLDPNRGSIK
PMQVLFSGEATHRKYYSTTHGALLSGQREAARLIEMYRDLFQQGT
Download sequence
Identical sequences M3YB11
ENSMPUP00000008518 XP_004772891.1.14098 XP_004772892.1.14098 XP_004772893.1.14098 XP_012901528.1.14098 XP_012901530.1.14098 XP_012901531.1.14098 ENSMPUP00000008518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]