SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008564 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008564
Domain Number 1 Region: 6-56
Classification Level Classification E-value
Superfamily Ras GEF 0.000000706
Family Ras GEF 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008564   Gene: ENSMPUG00000008633   Transcript: ENSMPUT00000008704
Sequence length 70
Comment pep:novel scaffold:MusPutFur1.0:GL898129.1:2692:3858:1 gene:ENSMPUG00000008633 transcript:ENSMPUT00000008704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERADKLEAAIDHLVPAVLRQDLHCVHTSLDTYDTFASTGEVLDQLCARFGCYYSTYEE
VNRPQEQRDM
Download sequence
Identical sequences M3YB57
ENSMPUP00000008564 ENSMPUP00000008564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]