SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008639 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008639
Domain Number 1 Region: 335-646
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.45e-122
Family Mammalian PLC 0.00000003
Further Details:      
 
Domain Number 2 Region: 177-330
Classification Level Classification E-value
Superfamily EF-hand 7.78e-44
Family EF-hand modules in multidomain proteins 0.00021
Further Details:      
 
Domain Number 3 Region: 652-777
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-29
Family PLC-like (P variant) 0.00013
Further Details:      
 
Domain Number 4 Region: 50-161
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-20
Family Pleckstrin-homology domain (PH domain) 0.0000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008639   Gene: ENSMPUG00000008709   Transcript: ENSMPUT00000008781
Sequence length 780
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:1524697:1544379:1 gene:ENSMPUG00000008709 transcript:ENSMPUT00000008781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCGRWRSCRRRPEEPSVPAQVATSVALAPPDGGSRRPGLRALKKMGLTEDEDVRAMLQG
SRLCKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRR
FGGAFPPARCLTIAFKGRRKNLDLAAATAEEAQRWVRGLAKLRARLDAMSQRERLDQHTW
IHAYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNEWLEGAEIEEF
LRRLLKRPELEEIFHRYSGEDRVLSAPELLEFLEDQREDGATLAHAQKLIHTYELNETAK
QHELMTLDGFMMYLLSPEGAALDPAHTCVFQDMGQPLSHYFISSSHNTYLTDSQIGGLSS
TEAYVRAFAQGCRCVELDCWEGPGGEPIIYHGHTLTSKILFRDVVQTVRDHAFTLSPYPV
ILSLENHCGLEQQAVMAHHLRTILGDALVTQGLDMQNPEELPSPEQLKGRVLVKGKKLPA
ARSEDGRILSDQEEEEEEEEEEVEAAEQRRRAKQISPELSALVVYCCATRLRTLRPNPVP
PQPCQVSSLSERKAKKLIREAGNSFVRHNAHQLTRVYPLGLRMNSANYSPQEMWNSGCQL
VALNFQTPGYEMDLNAGRFLINGQCGYVLKPACLRQPDTTFDPECPGPPRTTLTIQVLTA
QQLPKLNTEKPNSIVDPLVRVEVHGVPADCARKETNYVLNNGFNPRWGQTLQFQLRAPEL
ALVRFVVEDYDATSPNDFVGQFTLPLDSLKQGYRHIHLLSKDGASLSPATLFVHIRVQRF
Download sequence
Identical sequences M3YBD2
ENSMPUP00000008639 ENSMPUP00000008639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]