SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008710 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008710
Domain Number 1 Region: 560-671
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.58e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.0004
Further Details:      
 
Domain Number 2 Region: 37-206
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-33
Family G proteins 0.00000192
Further Details:      
 
Domain Number 3 Region: 304-379,499-544
Classification Level Classification E-value
Superfamily PH domain-like 9.35e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 683-773
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000529
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008710   Gene: ENSMPUG00000008780   Transcript: ENSMPUT00000008853
Sequence length 805
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897015.1:958080:996442:1 gene:ENSMPUG00000008780 transcript:ENSMPUT00000008853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLPGCLEVLPLFLELPRTWSEDSFVNSQEWTLSRSVPELKVGIVGNLSSGKSALVHRY
LTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPELQFAAWVDAVVFVFSLEDEIS
FQTVYNYFLRLCSFRNASEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETC
ATYGLNVERVFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNG
GSSAFSDYSSSVPSTPSVSQRELRIETVAASSTPTPVRKQSKRRSNIFTSRKGADLDREK
KAADCKVDSIGSGRAIPIKQGVLLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLHDYMQN
IHGKEIDLLRTTVKVPGKRLPRATPATAPGTSPRANGLASERSTSQLGGGTGAPYSASNP
AWAGPRPEGLHQRSCSVSSADQWSDALPPASGPAEVLSSSPKLEPPPSPHSNRKKHRRKK
STGTPRPDGPSSAAEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQG
CRSAKDKTRLGNQNAALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGTHRH
LGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALDGYAKPGPDACREEKERWIR
AKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTAL
HLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGL
APAPNREPANGTSASAELHRSPSLL
Download sequence
Identical sequences M3YBK3
ENSMPUP00000008710 ENSMPUP00000008710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]