SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008738 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008738
Domain Number 1 Region: 7-67
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000196
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008738   Gene: ENSMPUG00000008808   Transcript: ENSMPUT00000008881
Sequence length 660
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:1001205:1268055:-1 gene:ENSMPUG00000008808 transcript:ENSMPUT00000008881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCNTEKIYKEFYRSEVIKNSLNPTWRSLDF
GIMPDRLDTSVSCFVVKIWGGKENIYHLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLND
GYYGAPFEHKGYSNAQKNILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKE
IEEKLRLTSTSNELRKQSECLQLKILVLRNELERQKKALGREVALLHKQQIALQDKGSAF
SAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDY
FVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNI
NDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFME
HGLMVRCDRHHTSSAIPVPKRQSSIFGGTDVGFSGGIPSPDKGHRKRASSENERLQYQTP
PPSYNSALTQPIPAIPSAGESERKTTSLSSSLDTSLDFSKENKKKGVDLGDRFNGGHVGV
STGQEQEEALSGHASTVNGTLLPGEQAGSSSVRLPGEYHPGSEPELCCTVEQAEEIIGME
ATGFTSGDQLEAFNCIPVDNAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK
Download sequence
Identical sequences M3YBN1
ENSMPUP00000008738 ENSMPUP00000008738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]