SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008756 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008756
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.97e-43
Family Cofilin-like 0.000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008756   Gene: ENSMPUG00000008826   Transcript: ENSMPUT00000008900
Sequence length 142
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:4017001:4055819:1 gene:ENSMPUG00000008826 transcript:ENSMPUT00000008900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQDFIRECTDDVRLFA
FVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKEL
EEDFIKSELKKAGGANYDAQTE
Download sequence
Identical sequences M3YBP9 U6CRL0
XP_004753943.1.14098 ENSMPUP00000008756 ENSMPUP00000008756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]