SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008771 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008771
Domain Number 1 Region: 17-148
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.97e-33
Family Gelsolin-like 0.00000181
Further Details:      
 
Domain Number 2 Region: 137-239
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.85e-28
Family Gelsolin-like 0.00000187
Further Details:      
 
Domain Number 3 Region: 247-348
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.01e-25
Family Gelsolin-like 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008771   Gene: ENSMPUG00000008841   Transcript: ENSMPUT00000008915
Sequence length 349
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:24976699:24988433:-1 gene:ENSMPUG00000008841 transcript:ENSMPUT00000008915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTRLPQSGSPFPASVQDPGLHVWRVEKLKPVPVARESQGVFFSGDSYLVLHNGPEELSH
LHLWIGQQSSRDEQGACAMLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG
VDSAFHKTSPGAAPAAIKKLYQVKGKKNIRATERALSWDSFNTGDCFILDLGQNIFAWCG
GKSNILERNKAWDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDL
TADRTNAQAAALYKVSDATGQMNLTKVADSSPFALELLLSDDCFVLDNGLCGKIYIWKGR
KANEKERQAALQVAEDFISRMRYAPNTQVEILPQGRESPIFKQFFKDWK
Download sequence
Identical sequences M3YBR4
XP_004742369.1.14098 XP_012906659.1.14098 XP_012906661.1.14098 ENSMPUP00000008771 ENSMPUP00000008771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]