SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008785 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008785
Domain Number 1 Region: 122-216
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-21
Family PDZ domain 0.0000782
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008785
Domain Number - Region: 9-45
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00109
Family PDZ domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008785   Gene: ENSMPUG00000008855   Transcript: ENSMPUT00000008929
Sequence length 756
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897267.1:105755:111083:-1 gene:ENSMPUG00000008855 transcript:ENSMPUT00000008929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSHGGVSLLQVNGKELSKLSQEQTLEALRSSKEPLVIQVLRRSPRLRGDSSCHDLQLVD
SGTQTDITFEHIMALGKLRPPTPPMVILEPYVLSELPPINHEYYDPAEFMEGGPQEADRM
DELEYEEVELYKTSHRDKLGLMVCYRTDEEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQ
INGVDVQNREEAVAILSQEENTNISLLVARPESQLAKRWKDSDRDDFLDEFGSEHEGDLR
ARKLRSPPAQQLGHEMEKGVPDVGTGLSNSQELDSGVGRTDESTRTEESSEHDLLGDEPA
SAANTPGALRKSRDLHFSMDSLLAEGAGLGGGDVPGLTDEEYERYRELLEIKGHLENGNQ
PGLLFPRAAGGNSALDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQKMQQLRERCMKA
WLLEEESLYDLAAGEPKKHELSDISELPEKSDKDSTSAYNTGESCRSTPLLAEPSPESPL
RRAAAGNSNLNRTPSGPVVSAHPKAPPLQGSPAKFRSLSRDPEVGRRQHAEERVRRSPKT
GATLERVGPEGSPYLSRRHRGQGQEAEHYHSCVQLAPPRSLEELGQGPLSLAAGPRVGGA
AVAPEAPRMEWKVKVRSDGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMG
RYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKAELNIIALSHRKTMKKRN
KKILDNWITIQEMLAHGTRSADGKRVYNPLLSVTTV
Download sequence
Identical sequences M3YBS8
ENSMPUP00000008785 ENSMPUP00000008785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]