SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008823 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008823
Domain Number 1 Region: 297-349
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000428
Family Myb/SANT domain 0.0000993
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008823
Domain Number - Region: 38-168
Classification Level Classification E-value
Superfamily BAH domain 0.0068
Family BAH domain 0.015
Further Details:      
 
Domain Number - Region: 402-442
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0128
Family Erythroid transcription factor GATA-1 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008823   Gene: ENSMPUG00000008893   Transcript: ENSMPUT00000008967
Sequence length 621
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897058.1:2187573:2351882:1 gene:ENSMPUG00000008893 transcript:ENSMPUT00000008967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYGLHFECALPNIESHRLTNVNFLLKRLSSLLPLITDYVYFENSSSNPYLIRRIEELNK
TATGNVEAKVVCFYRRRDISNTLIMLADKHAKEIEEESETTIEADLTDKQKHQLKHRELF
LSRQYESLPATHIRGKCSVALLNETESVLSYLDKEDTFFYSLVYDPSVKTLLADKGEIRV
GPRYQADIPEMLLEGESDEREQSKLEVKVWDPNSPLTDRQIDQFLVVARAVGTFARALDC
SSSVRQPSLHMSAAAASRDITLFHAMDTLYRHSYDLSSAISVLVPLGGPVLCRDEMEEWS
ASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEAES
KLKQVYIPTYKPNPNQISASNGKPGAVNGAVGTTFQPQNPLLGRACESCYATQSHQWYSW
GPPNMQCRLCATCWLYWKKYGGLKMPTQSEEEKLSPSPTTEDPRVRSHMSRQAMQGMPVR
NTGSPKSAVKTRQAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVPINYAAIRAEYADRH
AELSGSPLKSKSTRKPLACIIGYLEIHPSKKPNVIRTTPSLQTPTTKRMLANPNHTSLSI
LGKRNYSHHNGLDELTCCVSD
Download sequence
Identical sequences M3YBW6
ENSMPUP00000008823 ENSMPUP00000008823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]