SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008886 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008886
Domain Number 1 Region: 142-266
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-27
Family Synaptotagmin-like (S variant) 0.0019
Further Details:      
 
Domain Number 2 Region: 266-403
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.82e-26
Family Synaptotagmin-like (S variant) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008886   Gene: ENSMPUG00000008956   Transcript: ENSMPUT00000009030
Sequence length 417
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897014.1:3784684:3792890:-1 gene:ENSMPUG00000008956 transcript:ENSMPUT00000009030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKVALVVGGLAGALLLLLLLIWVSCCLWKKLRTLSTYEELPGSTTASSVQGGKLYPPP
ARTQTSRPPGVPFVVPPSLQDQDWVPLHRGEWAQAPQDPCLSSEFLPRLSSGSVGNTGTV
GTINPDLYKFLEDKSETNFPEGCLGRLWFSVEYQQDAERLLVGLIKARRLRAPSESCSPL
VKLHLLPDERRFLQSKTKRKTSSPQFDEHFIFQVSSKNITQRVLRFSVYHVDRQRKHQLL
GQVFFPLRNEPLAGDCPHVIWRDLEAESGEPPSEFGDLQFCLSYNDCLCRLTVVVLRAKG
LQLQEDTSFVSVFVKVSLMNHNKFVKCKKTSAVLGSANPVYSETFSFKADPAELDTASLS
LTVLQSTRGENSHQLGRVVVGPYMYARGRQLEHWNAMLSKPKELVKRWHALCPTPEP
Download sequence
Identical sequences M3YC29
ENSMPUP00000008886 ENSMPUP00000008886 XP_004765871.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]