SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008888 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008888
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.18e-22
Family Ubiquitin-related 0.00000904
Further Details:      
 
Domain Number 2 Region: 464-539
Classification Level Classification E-value
Superfamily UBA-like 9.94e-20
Family UBA domain 0.0000909
Further Details:      
 
Domain Number 3 Region: 349-416
Classification Level Classification E-value
Superfamily UBA-like 0.00000000126
Family UBA domain 0.018
Further Details:      
 
Domain Number 4 Region: 433-470
Classification Level Classification E-value
Superfamily UBA-like 0.000000292
Family UBA domain 0.021
Further Details:      
 
Domain Number 5 Region: 235-387
Classification Level Classification E-value
Superfamily TPR-like 0.0000104
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008888   Gene: ENSMPUG00000008958   Transcript: ENSMPUT00000009032
Sequence length 614
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897015.1:1157561:1184616:1 gene:ENSMPUG00000008958 transcript:ENSMPUT00000009032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKEGSLALKDLAKKYSDRLECCENEVEKII
EEIRCKAIDRGTGNENYKTTGIATIEVFLPPRLRKDRKNLLETRLHITGRELRSKIAETF
GFQENYIKIVINKKQLQLGKTLEEQGVTHNVKAMVLELKQSEEDVRKHFQVEEEEQNEAE
LKEKRIQRTKRGLEILAERAETVVDPETTPYLDIANQTGRSIRIPPSERKALMLAMGYHE
KGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECLD
DAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNGEEARD
YLNKARQLFKELYIDPSKVHNLLQLGFTAQEARLGLRACDGNVDHAAAHISSRREELAQI
RKEEKEKKRRRLESINSLKGMGYSTHAAKQALYQAAGNLDEALKILLSNPQMWWLNDSDP
ETSSHQESPSQENIEQLVYMGFDAVAANAALRVFRGNVQLAAQTLAHNGGSLPPDLQLAA
EDASSTPSTSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEY
LSYVENIKSATRKN
Download sequence
Identical sequences M3YC31
ENSMPUP00000008888 ENSMPUP00000008888 XP_004766038.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]