SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008897 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008897
Domain Number 1 Region: 74-260
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.82e-71
Family T-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 2468-2548
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000419
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008897   Gene: ENSMPUG00000008968   Transcript: ENSMPUT00000009042
Sequence length 3109
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:8414247:8502292:1 gene:ENSMPUG00000008968 transcript:ENSMPUT00000009042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNRDACALASSVSSPGKS
KGRICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNMK
YILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLK
LTNNTLDQEGHIILHSMHRYLPRLHLVPAEKATEVIQLNGPGVHTFTFPQTEFFAVTAYQ
NIQITQLKIDYNPFAKGFRDDGLNSKPQRDGKQKNSSDQEGNSVPGSPGQRVHLTEGEGS
EIQLTDSDSLSRGHETSGKCLEKPSLSIKRDFLGFMDIDSALGEVPQLKQEVSESLVANN
FEDDPHVVSPLDPNENFDVVIKEEPVDDYEYELAECPEGVTIKQEETDEETDVYSNSDDD
PILEKQLKRHNKVDNLEADHPSSKWLPNSPSGVAQAKMFKLDAGKMPVVYLEPCAVTKST
VKISELPDNMLSTSRKDKSSVLTELDYLPTYIENTDETGFCLGKESDNGLRKHSPDLRVV
QKYPLLKEPQWKYPELSDSINTERILDSSKSSAGDPFLAKEDLGRRRTTVLKISTASKVV
NANQNVPSNIPGKRGRPRKLKLSKAGRPPKSTGKSLTSTKSAPLGPGSNFPDVKPDLEDV
DGVLFVSFESKEALDIHAVDGTAEEPCSLQASTTNDPGCRARISQLEKELIEDLKALRHK
QVIHPGLQEVGLKLNSVDPTMSIDLKYLGVQLPLAPATSFPFWNLTGTNPASPDAGFPFV
SRTGKTNDFTKIKGWRGKFHSASASRSEGGNSEGPLKNRSAFCSDKLDEYLENEGKLMET
SMGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVPSASRKAKS
QNRQTTFGGRTKSSYKSILPYPISPKQKHTQVIPGDKVAKNSSSTISENQVNNFVVPTLD
ENTFPKQISLRQAHQQQQQQQQGTRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERADV
SLTTLLTAQASLKTKPIHTIIRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMFG
CTCLKRKVVLVKGGSKAKHFQRKAAHRDPVFYDALGEEQRGEEEGVREEEEQLKEKKRRK
KLEYTICETEPEQPVRHYPLWVKVEGEVDPEPVYIPTPSVIEPMKPLLLPQPEVLPATVK
GKVLTGIKPARAYTPKPNPVIREEDKDPVYLYFESMMTCARVRVYERKKEEQRQPSPSPS
PSFQQQGSCQSSPENCSVKEPDSEQQPLKPVTCDLEDDSDKLQEKSWKSSCNEGESSTSY
VHQRSPGGPTKLIEIISDCNWEEDRNKILSILSQHINSNMPQSLKVGNFIIELASQRKSR
GEKNPPVYSSRVKISMPSCQDQDDMAEKSGSETPDGPLSPGKMDDISPVQTDALDSVRER
LHGGKGLPFYAGLSPAGKLVAYKRKPSSSTSGLIQVNGKSYPQAKLLLGQMGALHPANRL
AAYITGRLRPSVLDLSTLSTVISKVASNAKVAASRKPRTLLPSTSNCKTASSSGATTNHP
GKNLKAFVPAKRPIAARPSPGGVFTQFVMSKVGALQQKIPGVSTPQPLTGPQKFSIRPSP
VMVVTPVVSSEPVQVCSPVTAAVTTTTPQVFLENVTAVTPMTAISDVGTKETTYSSGATT
AGVVEVSETNTSTPVTPSQSTATVNLIKTTVASVAFPKSLVASPPTITLPVASTASTSIV
VVTTAASSSMVTTPTSSLGSVPIILSGIDGSPPVSQRPENAPQIPVATPQVSSNPVKRTG
PRLLLIPVQQGSPTLRPVPNTQLQGHRMVLQPVRSPSGMNLFRHPNGQIVQLLPLHQLRG
SNTQPNLQPVMFRNPGSVMGIRLPTPSKPSETPPSSASSSAFSVMNPVIQAVGSSPAVNV
ITQAPSLLSSGPSFVSQSGTLTLRISPPEPQSFASKTGSETKITYSSGGQPVGTASLIPL
QSGSFALLQLPGQKPVPSSILQHVASLQMKRESQSADQKDGTSFLKREQDTKKALQSEGE
AIDSGANVIKQNSGAAASEEILHDSLVDGGDHLDEESLTEESPIIVKPSQHSCITGSHTG
EDYKDVDEEYGIRNHNNSKEKLTVLEVKTISKKASNVTVQSVSSIQLKKLGDVKVEQQKG
LENPEEKSNEFPVFSKEESKLELSGSKVVEQQSIPQPEAKEKGCGDSLEKDSIRERWRKH
LKGPLTQKCVGTSQECKKEADEQLIKEIKTCQENSDVFQQEQGISDLLGKSETTENVRVL
KTECDSWSRISSPTAFSSVPRRATKGSRGEGHFQGHLLLSGEQIQPKQEKKGGRSSADLT
VLDLEEEDEEDENEKTDDSIDEIVDVVSDYQSEEVDDVDKNNCIEYIEDDEEQVDIETVE
ELSEEINVSHVKTTAAQTQTFKQPCRTHISADEKAAERSRKAPPIPLKLKPDYWSEKLQK
EAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLHSSKVSKSLILTRAFSEIQGLTD
QADKLIGQKNLLTRKRNILIRKVSSLSGKTEEVVLKKLEYIYAKQQALEAQKRKKKMGSD
EFDVSPRTSKQQEGSASSVDLGQMFINNRKGKPLILSRKRDQATENTSPSNTPHTSANIV
MTPQGQLLTLKGPLFSGPVVTVSPALLEADLKPQVATSAVAQSENDDLFMMPRIVNVTSL
ATEGGLGDMGGSKYPHEVPDGKPSDHLKSTIRNEDNSFEDSGRISSRSNHREGRMALGST
PVFLANKDSGFPQIVDVSSMQETQEFLPKKISGEMRGIQYKWKECESRREKPKPKESTFH
KLKMKDLKDSSIEMELRKVASAIEEAALDPSELLTNMEDEDDTDETLTSLLNEIAFLNQQ
LNDDSVSLAELPSSMDTEFTGDARRAFISKLPPGNRATFQVGHLGTGLKELPDVQGESDS
VSPLLLHLEDDDFSENEKQLAEPASEPDVLKIVIDSEIKDSLLPHRKASDGGKSTSGVPA
EPESVSSPPVLHMKAGLENSSTTDTLWRPMPKLAPLGLKVANPSSDADGQSLKVMPCLAP
VAAKVGSVGHKMNLTGNDQECRESKVMPTLAPVVAKLGNSGASPSSAGK
Download sequence
Identical sequences M3YC40
ENSMPUP00000008897 ENSMPUP00000008897 XP_004751216.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]