SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008931 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008931
Domain Number 1 Region: 112-300
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-36
Family BAR domain 0.011
Further Details:      
 
Domain Number 2 Region: 7-74
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-18
Family DBL homology domain (DH-domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 607-665
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-16
Family SH3-domain 0.00025
Further Details:      
 
Domain Number 4 Region: 365-451
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008931   Gene: ENSMPUG00000009003   Transcript: ENSMPUT00000009078
Sequence length 671
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896920.1:10778187:10921905:-1 gene:ENSMPUG00000009003 transcript:ENSMPUT00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEGKPNLLDMGSLMIKPIQRVMKYPLLLCELRGSTPPSHPDFRALGDAFTAVKDVNVNI
NELKRRKDLVLKYKRNDEEESLKDKLSKLNIHSISKKSKRVTNHLKILTRGEPQVKDNTF
NREEKLFRSLEKTVRHCMKNITLCHQHIQDYTCISLSRAVSSVWQFCINESKRERETFLQ
RNHKMIKNQMYSNYAAHLQRLVLMPLSALLSLFTGPQKLIQKRYDKLLDCNSSLPRVAGD
ETDLAKKEYEALNAQLVEELQVFNQAARKILWNCLCSFMALLRDLTLAAQQVYSTVAPNL
FLLMVIWMVPQLDSRISEIQNRVLEEVQNLNFVKDNSATFIERKLSFEKKKSVQILVSLP
EVPRQTDIHRSKLLSTYGKEELYQAKRKCNATQEYDINLLEGELVAVVEQKDPLGSTSRW
LVDTGIIKGYVYSSFLKPYNPAKVQKVDTENRFGDDDFDNISLFVSSRPATDSVTGTPES
SISDSSSSLSGTCGKFETNGTDVDSSQEVDEQVTITTLLSCTQSEAKNKVCPKTPVQDRR
PHRNISLNVLIPVNRGTWASGFQAFPSIIGKFLHSHPTQKAWTFSEYFRISLSDDPEPLE
NNGEETVGNKIFYAVHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYV
PANYLGKMTYA
Download sequence
Identical sequences M3YC74
ENSMPUP00000008931 ENSMPUP00000008931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]