SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008945 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008945
Domain Number 1 Region: 78-269
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-86
Family p53 DNA-binding domain-like 0.0000000116
Further Details:      
 
Domain Number 2 Region: 301-340
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.000000000249
Family p53 tetramerization domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008945   Gene: ENSMPUG00000009017   Transcript: ENSMPUT00000009092
Sequence length 375
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896973.1:6554973:6565648:1 gene:ENSMPUG00000009017 transcript:ENSMPUT00000009092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDPQSELTIDPPLSQETFSELWNLLPENNVLSPAVDELLSEGVNWLGEGSNDAPRMPAT
PAPAAPGPAPSWPLSSFVPSPKTYPGTYGFRLGFLHSGTAKSVTCTYSPSLNKLFCQLAK
TCPVQLWVSSPPPADTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHLIRVE
GNLRAKYLDDRNTFRQSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLE
DSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALPPSTSSSPPQ
KKKPLDGEYFTLQIRGLERYNMFRELNEALELKDALNGKEPGGSRPHSSHLKAKKGQSTS
RHKKPMLKREGPDSD
Download sequence
Identical sequences M3YC88
ENSMPUP00000008945 XP_004760313.2.14098 ENSMPUP00000008945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]