SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008953 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008953
Domain Number 1 Region: 179-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-75
Family Nuclear receptor ligand-binding domain 0.0000000108
Further Details:      
 
Domain Number 2 Region: 105-191
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008953   Gene: ENSMPUG00000009025   Transcript: ENSMPUT00000009100
Sequence length 438
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896900.1:36719643:36882879:-1 gene:ENSMPUG00000009025 transcript:ENSMPUT00000009100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLNRMSADDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGAHANG
LDSPPMFAGAGLGSTPCRKSYEDCAGGLMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHY
GVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRL
DRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEG
DIKALTTLCDLADRELVVIIGWAKHIPGFSNLSLGDQMSLLQSAWMEILILGIVYRSLPY
DDKLVFAEDYVMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSM
YIEDLEAVQKLQDLLHEALQDYELSQRHEEPRRTGKLLLTLPLLRQTAAKAVQHFYSVKL
QGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences M3YC96
ENSMPUP00000008953 XP_004739252.1.14098 ENSMPUP00000008953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]