SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008995 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008995
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.7e-18
Family THAP domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008995
Domain Number - Region: 152-205
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0112
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008995   Gene: ENSMPUG00000009068   Transcript: ENSMPUT00000009143
Sequence length 222
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897018.1:1697829:1714729:-1 gene:ENSMPUG00000009068 transcript:ENSMPUT00000009143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAIGCASRCLPNSKLKGLTFHVFPTDENVKRKWVLAMKRLDVNAAGIWEPKKGDV
LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPSHLQEKREKLHCRKNFTLKTLPVTDHNH
QLVGASSCTEEFQSQFIFEHSYSVMDSPKKLKHKLDHVISELEDTKKSLRNVLDREKRFQ
KSLRKTIRELKDECLISQETANRLEAFCWECCQESIERDYIS
Download sequence
Identical sequences M3YCD8
ENSMPUP00000008995 ENSMPUP00000008995 XP_004766320.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]