SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008997 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008997
Domain Number 1 Region: 311-478
Classification Level Classification E-value
Superfamily Sec7 domain 1.18e-54
Family Sec7 domain 0.0000768
Further Details:      
 
Domain Number 2 Region: 521-654
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008997   Gene: ENSMPUG00000009070   Transcript: ENSMPUT00000009145
Sequence length 779
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896911.1:14744633:14777933:-1 gene:ENSMPUG00000009070 transcript:ENSMPUT00000009145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDKLPSVLPGESGAAWDPSLESEEEPGVQNGMAYSQDLNSSYNSPAHEMRGTLVDTEE
PIQGPDIALHGLSLGLSFTNGLVLGPDSNILEDSTESRPWRAGGLAEGDNVSKNLCLDTE
DTQLGLGGPGEPDVRDGFSATFEKIVESDLLRGTQYSSLDSLDVLSLTDESDSCVSFEAP
LTPLIQQRAHDSPEPGPSLGTGDMGTEGDMGAAGGDGELGSPLRCSISSSRSENVLSRLS
RTAVPNGFHEDGPRGPGGDEEEEEEEEEEDTDKLLNSASDPSLKDGFSDSDSELSSSEGL
EPGSTDPLTNGCQGVSEAARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFD
FSGLTLDRALRTFLKAFPLMGETQERERVLTHFSRRYRQCNPEDSTSEDGIHTLTCALML
LNTDLHGHVNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELR
KSLSELVDDKFGTGTKKVTRILDGGNPFLDIPQALSATTYKHGVLTRKTHADMDGKRTPR
GRRGWKKFYAVLKGTILYLQKDEYRPDKALSEGDLKNAIRVHHALATRASDYSKKSNVLK
LKTADWRVFLFQAPSKEEMLSWILRINLVAAIFSAPSFPAAVSSMKKFCRPLLPSCTTRL
CQEEQLRSHENKLRQVTAELAEHRCHPIEKGVKSKEAEENRLKEHYLTFEKSRYETYIHL
LAVKIKVGSDDLERIEARLATLEGDDPSLRKTHSSPALSQGHGTMTGSRVTKDTTGPDT
Download sequence
Identical sequences M3YCE0
ENSMPUP00000008997 XP_004744875.2.14098 XP_012907881.1.14098 ENSMPUP00000008997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]