SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009003 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009003
Domain Number 1 Region: 216-546
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.41e-77
Family Pancreatic carboxypeptidases 0.00000262
Further Details:      
 
Domain Number 2 Region: 38-200
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.87e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00044
Further Details:      
 
Domain Number 3 Region: 547-644
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 9.81e-19
Family Carboxypeptidase regulatory domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009003   Gene: ENSMPUG00000009076   Transcript: ENSMPUT00000009151
Sequence length 657
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897073.1:3570158:3575064:1 gene:ENSMPUG00000009076 transcript:ENSMPUT00000009151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRKKLIRPRPMATARPPVTTTTTGALDLPEEQDPGCPPLGLESLRVSDSQLEASSSQS
FGLGPHRGRLNIQSGLEDGDLYDGAWCAEQQDTKPWFQVDARHPTRFSGIITQGRNSIWR
YDWVTSYKVQFSNDSQTWWGSRNRSSGMEAVFPANSDPETPVLNLLPEPQVARFIRLLPQ
TWLQGGASCLRAEILACPVSDPNDLFPKAPALGSSDPLDFRHHNYKAMRKLMKQVNEKCP
NITRVYSIGKSHQGLKLYVMEMSDQPGEHELGEPEVRYVAGMHGNEALGRELLLLLMQFL
CHEYLRGDPRVTRLLTETRIHLLPSMNPDGYETAFRRGSELVGWAEGRWNQQGIDLNHNF
ADLNTPLWEAEDDGLVPDTVPNHHLPLPTYYTLPNATVAPETRAVIEWMQRIPFVLSANL
HGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGTNWAMQDPDRRPCHSQDFS
SLGNIINGADWHTVPGSMNDFSYLHTNCFEITVELSCDKFPHENELPQEWENNKEALLTY
LEQVRMGITGVVRDKDTEQGIADAVIAVEGINHDVTTAWGGDYWRLLTPGDYVVTASAEG
YHTATRKCWVPFEEGPVPCNFHLTKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKN
Download sequence
Identical sequences M3YCE6
XP_012901536.1.14098 ENSMPUP00000009003 ENSMPUP00000009003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]