SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009036 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009036
Domain Number 1 Region: 60-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000785
Family FCH domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009036   Gene: ENSMPUG00000009112   Transcript: ENSMPUT00000009187
Sequence length 288
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897034.1:3618700:3645417:-1 gene:ENSMPUG00000009112 transcript:ENSMPUT00000009187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRSLENRDSQTRQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINVYAS
TETPNLKQGLKNFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTAR
NREAKQLTQLERTRQRNPSDRHVILQAETELQRATMDATRTTRHLEETIDNFEKQKIKDI
KTIFSEFITIEMLFHGKALEVYTAAYQNIQKIDEEEDLEVFRNSVYPPDYSSRLDIVRAN
SKSPLQRSLSAKCISGTGQVSTCRLRKDQQAEDDDEEDEDLDVTEEEN
Download sequence
Identical sequences M3YCH9
ENSMPUP00000009036 ENSMPUP00000009036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]