SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009046 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009046
Domain Number 1 Region: 231-290
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.78e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009046   Gene: ENSMPUG00000009121   Transcript: ENSMPUT00000009197
Sequence length 323
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:25261133:25296311:1 gene:ENSMPUG00000009121 transcript:ENSMPUT00000009197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEHGATATNGL
RDRTQRLQPVAAPVPAQLAPAVPSGGGADPAGERRGARAPEVSDARKRGFALGAVGPGLP
TPPPPPPPPPPPPPPAPQGQVPGGPEAQPFREPGLRPRILLCAPPARPTPSAPPAPPESS
VRPAPPTRPGESSYSSISQVIYNNHPDSSASPRKRPGEATTAASEIKALQQTRRLLANAR
ERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLS
FSECVQRCTRTLQAEGRAKKRKE
Download sequence
Identical sequences M3YCI9
XP_004742399.1.14098 ENSMPUP00000009046 ENSMPUP00000009046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]