SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009069 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009069
Domain Number 1 Region: 497-527,566-630
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000132
Family Anti-sigma factor antagonist SpoIIaa 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009069   Gene: ENSMPUG00000009145   Transcript: ENSMPUT00000009221
Sequence length 656
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897034.1:5617446:5733511:-1 gene:ENSMPUG00000009145 transcript:ENSMPUT00000009221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTKRKKKGMLWSKMQTPHCEDFKQWCRRRLPILEWAPQYNLKENLLPDTMSGIMLAVQ
QVTQGLAFAILSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
LSSQNLTTQSNTSTLGLSEFELRRIGVAAAVSFLGGVIQVAMFALQLGSATFLLTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMEITYGLEVVGHIPKGIPPPRAP
PMNVLSAVITEAFGVALVGYVASLALAQGSAKKYKYSVDDNQEFLAHGLSNVIPSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCILVLIVIYAVGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAKTLSI
KNMKEMELKVKTEMDGETLQQVKIVSINNPLVFLNAKKFHTDIMTIIQKENVSNQLLDDV
SKCEQNTLLNSLSNGNCNEEASQPGPSEKCFLILDCSGVTFFDYSGVSMLVEVYNDCKSR
SVDVSLAHCTASLVKAMKYCGNPDSEKPIYFDSVSAALSNIYSNKNLSKLSDHSEV
Download sequence
Identical sequences M3YCL2
XP_004768651.1.14098 ENSMPUP00000009069 ENSMPUP00000009069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]