SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009070 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009070
Domain Number 1 Region: 28-57,173-309,405-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.19e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009070
Domain Number - Region: 301-476
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00712
Family FAD/NAD-linked reductases, N-terminal and central domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009070   Gene: ENSMPUG00000009146   Transcript: ENSMPUT00000009222
Sequence length 490
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:4469765:4482027:-1 gene:ENSMPUG00000009146 transcript:ENSMPUT00000009222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPAASPPPATAMSSWRNDPLGSGGSEPLTVVIIGNGPSGICLSYLLSGYTPYVKPDAEH
PHPLLQRKLAEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMESVLT
WKHQKERAIPHVVLGRNLPGGAWHSIEGSMVTLSQGQWMGLPDLPVKEWMRRRRRGLRNS
RATAGDIAHYYRDYVTKKSLGHNFVSGAVVTAVEWGTPESSGSGLREPGPLFQVSGFLTT
EDQSRQPFSLCARNVVLATGSSDSPARLGIPGENLPFVHYELSALEAATRAGTVSPGSDP
VLIVGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVYQMLRER
SVLSPGPYEGYRSLPEHRLVLLKEDRQAMLQDPGGLQKVFGVALVLVLIGSHPDLSFLPA
AGANLAVDPDQPLSAKRNPIDVDPFTYQSTHQEGLYAVGPLAGDNFVRFVQGGALAVANS
LLRKEARKPP
Download sequence
Identical sequences M3YCL3
ENSMPUP00000009070 ENSMPUP00000009070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]