SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009073 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000009073
Domain Number - Region: 87-131
Classification Level Classification E-value
Superfamily Tropomyosin 0.0124
Family Tropomyosin 0.0085
Further Details:      
 
Domain Number - Region: 249-295
Classification Level Classification E-value
Superfamily TM1646-like 0.0379
Family TM1646-like 0.009
Further Details:      
 
Domain Number - Region: 449-559
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0777
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009073   Gene: ENSMPUG00000009149   Transcript: ENSMPUT00000009225
Sequence length 579
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896986.1:1059944:1165673:1 gene:ENSMPUG00000009149 transcript:ENSMPUT00000009225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKQREEAEWESINMLLMRHGLAPLSLVKGTDLKDLIVFDKQSSQRMRQNLKTLVEETA
RQQNMIQELIETNQQLKNELQLEQSRAADHEQRANDLEQIMESVKSKIDELEDESLNRVC
QQQNIIEDLQKECRALQAKCQHYKKKRMEQQETIASLQKDIYRLTKEEEERIVTQNRVFA
YLCKRVPHTILDRQLLCLIDYYECKIRKLHKQRQYKENESLSEEEKDYRSLDASPTYKGL
LMSLQNQLKESKSKIDALLSEKLNLQKDLETRPTQHELRLYKQQVKKLEKALKKNIKLQD
LISQKKAEEPEKPDEPSKDNPQQALIDQRYFQVLNSINSIVHNPRAPVIIYKQSKGGTQH
FNKDLVQDCGFEHLIPIIEMWADQLTSLKDLYKSLKILSAELVPWHNFKKQDENEGIRIE
DLLFIVDTMLEEVENKEKDSNVPNLKTLQAIVSHFQKLFDVPSLNGVYPRMNEVYTRLGE
MNNAVRNLQELLELDSSSSLCVLVNTVGKLCKLINENVNEQVMQVLGPEDLQSIINKLEE
HEEFFPAFQAFTNDLLEILEIDDLDAIVPAVKKLKILSY
Download sequence
Identical sequences M3YCL6
ENSMPUP00000009073 XP_004762478.1.14098 ENSMPUP00000009073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]