SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009077 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009077
Domain Number 1 Region: 2538-2823
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-120
Family BEACH domain 0.0000000441
Further Details:      
 
Domain Number 2 Region: 2903-3103,3147-3184
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.51e-30
Family WD40-repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 2390-2515
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-18
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009077
Domain Number - Region: 1065-1202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00137
Family Glycosyl hydrolases family 16 0.045
Further Details:      
 
Domain Number - Region: 59-81,134-297,478-633
Classification Level Classification E-value
Superfamily ARM repeat 0.00187
Family Armadillo repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009077   Gene: ENSMPUG00000009154   Transcript: ENSMPUT00000009230
Sequence length 3186
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897014.1:4993179:5262282:1 gene:ENSMPUG00000009154 transcript:ENSMPUT00000009230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEVSRAEDRADYPGSKNEGQPDVAQPDFPHGGKSPGPTALWEMLERKFLEYQKLAHG
SPVEHQQSLLDLLPLFLKAWENSVGIICFPSLQRLAEDTSNQLAQEIQKALVGKPAEQAR
EAAGQLLRWKGDVHQDGYLLLKSVFVLTGTNSETLGRVAESGLPALLLQCLYLFFVFPLE
KDELLESDVQVQRMFVQMLLNICCESQGLEKLLSGNELQSLVIATTCLREHSCCFWKEPT
FCVLRAISKAQNLGIIQYLQAMDCIKLSLQNLSKLADSLPAPEVSEAVNLILGFVKDSYP
VSSALFLEFENGEGYPLLLKVLLRYDGPTKSEVDPHLEELLDLVVWLTTCGRSELKVFDS
VTYPQLEGFKFHHEASGVTVKNLQAFQVLQNVFHKASNPILCTKVLAAIRIMWAWNARNF
FLLEWTLQPISQFVEIVPLKAAPVQKQFFQLLEALVFELHYVPHEILRKVQCLIKESPES
PCSLVALQSVLKIVGRDLLFTDIFRDSGLLGLLLAQLRKRAKILRKSGNKESMLAVQDTE
RELTCVMLRTVLTLLRGSVRNAVVLKDHGMVPFIKIFLDDDWYRGASLSILEQLSVINAE
EYMSIIVGALCSSTQGELQLKLDLLQSLLRILETPKGRAAFRVSSGFNGLLSLLSDLEGS
LQEPPLQTWVMVPPSQTLDLVLHTLCALSAALHLDPVNGDFFKRNGLFEKLAEDLCLLGC
FGAQEEEGAPLHSGADTKARPFADLLSVAFTSTSPFPPKIQSCLQILSFLDSMASGTLHL
RRDLKESPRAGQDPVVNAQKEEAGRDAQGNFKQWPDLEERVDEGDAVIMHPGVLCIMVRL
LPRLYHADHPQLSQEIQCSMASHIQSLVKSEKNRQVMCEAGMLRTLMASCRRALTTSSSP
LHSGLIRIFEKLASQAIEPDVLRQFLSLGIPPPPSAATKILHSSCLHRGDPGGSGSQTAA
AGTGEGPAGAAMDAGPNPAVTHTLRASGTSQGSTTALQTSLSLISMTSPRHLQPQRAVLA
PSFVEFDMSMEGYGCLFIPTLSTVMGSSTEYLVSGGIGTGAARSFPPSGGLTFSCWFLIS
RHSTVLEGHPLRFLTLVRHLARTEQPFVCLSVSLCPDDLSLVVSTEEKAFQPLDIMEPED
DPEPSAGRQLRVRCGQLLACGQWHHLAVVITKEMKRNCTVSTYLDGQITGSAKMLYIQAL
PGPFLSMDPSSFVDVYGYIATPRLWKQKSSLIWRLGPTYLFEEAISVDTLEVINKLGPRY
CGNFQAVHAQGVDPDIEATPLIAEEKVSFGLHLASSSTTSVTDIRNTYSEVDSRLIAKEM
NISSRDNATPVFLLRNCAGHLSGSLRTIGAVAVSHLGVRVFHSIPAASSLDFIGGPTILL
GLISLATDDHTMYAAVKVLHSVLTSNVMCDRLMQHICGYQIMAFLLRKKSSLLNHRIFQL
ILSIAGTAELGFGSSAITNVGVFQHILCNFELWTNTADSLELSLFSHLAEILRSPREGPR
NAEIAHQAQLIPKLVFLFNEPGLTFSKIPTIIAILGCQLRGHFSIQDLLRIGLFVVYTLK
PSSVNERQICVDGGLDSSVPAGSQTSGKTIWLRNQLLEMLFSVISSSQLHLSSETKEEMF
LSLGPDWFLLLMQGHVHHSTTVLGLKLLLHFLASPSLRGRFKDGLCAGSWVERSSEGVDI
VIDNLKSQTPTPDQSPCLLPGFRVLKDFLGHHVHIPEVYLIVSTFFLQTPLTELTDGPKD
SLDAMLQWLLQKHHNEEILRAGLCTEGVLLLLEMLKATMSQPPGGSGDDAWEQSFPASVL
HFLGCVHSTYPQDPAWRAPEFLQTLAAVTFPLGTHKEPMTQPVQNASSPGVEAEGDDIAE
GPQAPAKSHPTRKQLREFMQRLLRDSLLAASNPKQWLPLEVLLEASPHNATSQQKRDFQS
EVLLSTMEIFHMLNGGNVPMLRGSKEPQPNAEAAAAPSLANISHFTQKLVEKLYSGMFSA
DPRHILLFITDRIVVVIENASSQRDAVISALYSSLNKVILYCLSKPQQSLSECLSLLSIL
GFLQEHWDIILATYNSNVSFLLCLMHCFLLLSERSYPEGFGLEPKPRMTPYHQVFLSPNE
EGREKGEEDLPSLSDVQHNIQKIVRTLWQQLVAQRRQELEDTCKIDLSVKPGESEVKIEE
ITPLWEETMLKAWQHYLASEKKLLTSRSSVGHHSKVSSWSGSLSSAMRLVPGRQAKEPEC
KTEDFVSCIENYRRRGQELYASLYKDHVQRQRCDSIKAANTWARIQEQLFGELGLWGQTA
EATLCSRWELDWREGPARMRKRIRRLSPLETLSPERLKENQDRNGSVSETNVEKQDELTP
KEAESGREEVAVDCTQLTFFPALHESLHSEDFLELCRERQVILQELRDHEKVTQKYSLVI
VQGHLVSEGVLLFGHQHFYICENFTLSPVGDVYCTRHCLSNISDPFIFNMCSKDRSSDHY
SCQSHSYGDLRELRQARFLLQDIALELFFQNGYSKFLVFHNNDRNMVFKSFCSFQPTLKG
KGITEDPLNLRRYPGFDRTMLQRWQKRDISNFEYLMHLNTAAGRTYNDYMQYPVFPWVLA
DYTSQTLNLTNPKTFRDLSKPMGAQTKERKLKFIQRFKEVEKTEGDMTVQCHYCTHYSSA
IIVASYLVRMPPYTQAFCSLQGGNFDVADRMFHSVKNAWESASRENMSDVRELTPEFFYL
PEFLVNGNAVEFGCMQDGTALGDVQLPPWADGDPRKFISLHRQALESDFVSANLHHWIDL
IFGYKQQGSAAVESVNTFHPYFYGDKVDLSSISDPLIRSTVLGFVSNFGQVPKQLFTKPH
PARTAAGKPSPGKDAALPGSLPSHPQPFFYNLQALKPSQVTVKDMYLFSLGSESPKGAIG
HIVPTEKSILAVERNKVLLPPLGNRTFSWGFDDFSCCLGNYGSDKILMTFENLAAWGRCL
CTVCPAPTTIITSGTSAVVCVWELSIAKGRPRSLHLRKALYGHTQAVTCLAASVTFSLLV
SGSQDCTCILWDLDHLTHVARLPTHREGISALAISDVSGTIVSCAGAHLSLWNVNGHPLA
SITTAWGSEGAITCCCVLEGPAWDTNHVIITGSQDGMVRIWRTEDMKTSVPGLAAPEEPS
TPPPSPRGHRWEKNLALCRELDVSLALTGKPSKTSPAVTALAVSRNQTKLLVGDEKGRIF
CWSAEG
Download sequence
Identical sequences M3YCM0
ENSMPUP00000009077 XP_004765902.1.14098 XP_004765903.1.14098 XP_012918583.1.14098 ENSMPUP00000009077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]