SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009084 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009084
Domain Number 1 Region: 757-884
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.66e-29
Family Synaptotagmin-like (S variant) 0.002
Further Details:      
 
Domain Number 2 Region: 309-429
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.29e-29
Family PLC-like (P variant) 0.012
Further Details:      
 
Domain Number 3 Region: 480-598
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.57e-17
Family PLC-like (P variant) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009084   Gene: ENSMPUG00000009161   Transcript: ENSMPUT00000009237
Sequence length 889
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896986.1:1175760:1226034:-1 gene:ENSMPUG00000009161 transcript:ENSMPUT00000009237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEPCAPGAPGDRGTQRDQRAPSPEPRLSSQLLPELYTFAARVLFYLAPVYLAGYVGL
SITWLLLGALLWMWWRRNRRGKLGRLAAAFEFLDNERQFISRELRDQHLPAWIHFPDVER
VEWANKIISQTWPYLSMIMENKFREKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKA
HTNQRNRRRVVLDLQICYIGDCEISAELQKIQAGVNGIQLQGTLRVILEPLLVDKPFVGA
VTVFFLQKPHLQINWTGLTNLLDAPGINEVSDSLLEELIAAHLVLPNRVTVPVKKGLDVT
NLLFPLPCGVIRVHLLEAEMLAQKDSFLGIRGKSDPYAKVSIGLQHFRSRTIYKDLNPTW
NEVFEFIVYEVPGQDLEVDLYDEDPDRDDFLGSLQICLGDVMTNRVVDEWFVLNDTTSGR
LHLRLEWLSLIANPEALIEDQGGLSTAILVVFLESACNLPRNPFDYLNGEYQAKKLSRFT
KNKVSRDPSSYVKLSVGKKTHMSKTCPHSKDPVWSQVFSFFVSNVAAEELHLKVLDDDQE
YALGVLEIPLCQILPYTDLTLEQRFQLDHSGLDSLISMRLVLRFLRVEEREMGSPYTGPE
ALKKGPLFIKKVDTNQESKAPSQGECPANLSCPPDPASDTKETSKSSMSATSATIVTTEP
MPQETGSEPKGKDHAKGFCESLGKKKSSGTIFLTVPGSHSPGPIKSPRPLKCPASPLAWP
PKRVAPSMSSLNSLASSCFDLTDISFNIEGGDLRQWRLGEIQLTVRYVCLRRCLSVLING
CRNLTPCTSSGADPYVRVYLLPERRWASRKKTSVKRKTLEPLFDETFEFFVPMEEVKKRS
LDVAVKNSRPLGSHRRKELGKVLIDLSKEDLIKGFSRWYELTPDGQPRS
Download sequence
Identical sequences M3YCM7
XP_004762473.1.14098 ENSMPUP00000009084 ENSMPUP00000009084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]