SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009122 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000009122
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily BRCT domain 0.000733
Family DNA-repair protein XRCC1 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009122   Gene: ENSMPUG00000009199   Transcript: ENSMPUT00000009275
Sequence length 264
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897072.1:1845288:1865176:-1 gene:ENSMPUG00000009199 transcript:ENSMPUT00000009275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPFSGKSFYLDLPAGKSLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREAKTESSRTSPR
GCPSPSEVRGQTPSMAHPKGGHTRPSQKPADSVPLSRGKELLQKAIRNQESSSGGSGGSS
SSLLTNARSWGVRILHVDGTVSAQGFRRGDLRLLKRSKYTAQGTGKQEGACPAESMAKLK
APFLKIEDESRKFRPFHHQFKSFPEVSFLGPKDASPFEATTTPGSSHCTREAKDREQSPQ
SAARTLPRRRKGFCECCQEAFEEL
Download sequence
Identical sequences M3YCR5
ENSMPUP00000009122 ENSMPUP00000009122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]