SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009220 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009220
Domain Number 1 Region: 149-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.43e-125
Family Transglutaminase core 0.00000000379
Further Details:      
 
Domain Number 2 Region: 7-148
Classification Level Classification E-value
Superfamily E set domains 1.54e-44
Family Transglutaminase N-terminal domain 0.0001
Further Details:      
 
Domain Number 3 Region: 500-611
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.42e-29
Family Transglutaminase, two C-terminal domains 0.00025
Further Details:      
 
Domain Number 4 Region: 614-709
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.93e-25
Family Transglutaminase, two C-terminal domains 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009220   Gene: ENSMPUG00000009294   Transcript: ENSMPUT00000009373
Sequence length 712
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897073.1:3809956:3823186:-1 gene:ENSMPUG00000009294 transcript:ENSMPUT00000009373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSLSSPCSGIRVTEVDWLSQKNGAAHHTQEYPGPELVVRRGQAFTLVLELNRPLEDQETV
IFTVETGPQASEDRHTKAVFQVSEPETGKNWTVVEEAQMENTVTVSITSPPNAAIGRYLM
STRVSSRRKQNDRKLGEFILLFNPWCPEDDVFLDSEEERQEYVLNDSGIIFRGVEKHIRA
QGWNYGQFEEDILNICLSILDRSPLHQNDPATDVSHRHDPIYVSRVISAMVNSNNDRGVV
QGQWQGKYGGGTSPLHWSGSVAILHKWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRV
VSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQV
LDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESWERVY
SDTKKIGRCISTKAVGSDSRVDITGLYKYPEGSRKERQVYRKAVRKLFSVEASGRRTRLR
RAGGRGLWREDLLEPATKPNITGKFKMLEPPRLGHDLSLALCLANLTSRAQKVRVNLSAA
TILYTRRPVAEILRKSHSVRLGPEEEKQIPITISYSQYKEDLTEDKKILLAAMCFVTKGE
KLLVEKDITLEDFITIKVLGPAVVGVDVVVKVMVVNPLLEKVEDCVLMVEGSGLLQGQLS
INVPTLEPQERASVQFNITPTKSGPRQLQVDLVSPHFPDIKGFVIIHVATAK
Download sequence
Identical sequences M3YD13
ENSMPUP00000009220 ENSMPUP00000009220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]