SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009230 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009230
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.3e-51
Family LplA-like 0.0000551
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009230   Gene: ENSMPUG00000009304   Transcript: ENSMPUT00000009383
Sequence length 231
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:2311220:2313241:1 gene:ENSMPUG00000009304 transcript:ENSMPUT00000009383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQPAVRLVLLGRVPYNELLALQERWLRRLQAEPGTEALSGTEAGALLLCEPAGPVYTSG
LRGGLTPEETTRLRALGAEVRTTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRTHVAALE
GCAVRLCELQNLRGARAGPPPYTGVWLGERKICAIGVRCGRHITSHGLALNCSTDLVWFD
HIVPCGLVGTGVTSLSEELQRHVTVDEVIPPFLDAFKETYKCTLISENSSN
Download sequence
Identical sequences M3YD23
ENSMPUP00000009230 ENSMPUP00000009230 XP_004768112.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]