SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009239 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009239
Domain Number 1 Region: 360-373,404-603
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.13e-30
Family Cofactor-dependent phosphoglycerate mutase 0.014
Further Details:      
 
Domain Number 2 Region: 240-305
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000414
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 20-72
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000102
Family UBA domain 0.00045
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009239
Domain Number - Region: 74-144
Classification Level Classification E-value
Superfamily LigT-like 0.00916
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009239   Gene: ENSMPUG00000009313   Transcript: ENSMPUT00000009392
Sequence length 626
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896984.1:5856947:5893006:1 gene:ENSMPUG00000009313 transcript:ENSMPUT00000009392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAETQLYAKVSNKHKGRSTASLLDPLLGMGFPAHTALKALAATGRKTVEEACDWLRCH
RNDPSLDDPIPQEYALFLCPTGTLLEKLQEFWRESKRQCTKNRAHEVFPHITLCDFFTCE
DHKVECLYEALKRAGDRILGSFPVVLPLVLHSSVSYLGFFVNDGPADVIRELALTFATEA
SVLADCTVKPCTKQLHLTLAHKFYPHHQRTLEELARAIHPGHSCQWTAALYSRDMRFVHY
QTLRALFQYKPQNVDELTLSPGDYIFVDPTQQEEASEGWVIGISQRTGCQGFLPENYTEP
AGESDTWVKHRTYTFSLAMDLMSRKDGEASSRRNGEPHPSQTSRDISSIQALQATIARRS
VLVVRHGERVDQIFGKSWLQQCSTPDGKYYRPDLNFPYSLPRRRNGIKDFENDPPLSSCG
IFQSRMAGEALLDSGIRVTAAFTSPALRCVQTARHILEELKLEKRIKIRVEPGIFEWTKW
ESGKTTPALMTLDELKEANHGRVLSPVLRPAFPLASLLPAESYDEYVERCAVSVGRIVSA
CPRDAGVILIVSHGSALDSCTRPLLGLPPRDSGDFAQLVRKVPSLGMCFCEENREEGKWE
LVSPPVKTLTHGSNAAFNWRNWLPGS
Download sequence
Identical sequences M3YD32
ENSMPUP00000009239 ENSMPUP00000009239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]