SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009241 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009241
Domain Number 1 Region: 747-860
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 6.28e-44
Family Clathrin adaptor appendage, alpha and beta chain-specific domain 0.000000927
Further Details:      
 
Domain Number 2 Region: 628-746
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 3.19e-42
Family Alpha-adaptin ear subdomain-like 0.000000633
Further Details:      
 
Domain Number 3 Region: 321-483
Classification Level Classification E-value
Superfamily ARM repeat 4.6e-20
Family Clathrin adaptor core protein 0.00000753
Further Details:      
 
Domain Number 4 Region: 1-108
Classification Level Classification E-value
Superfamily ARM repeat 4.32e-16
Family Clathrin adaptor core protein 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009241   Gene: ENSMPUG00000009315   Transcript: ENSMPUT00000009394
Sequence length 860
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897275.1:650030:681067:1 gene:ENSMPUG00000009315 transcript:ENSMPUT00000009394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYLFISVLVNSNSELIRLINNAIKNDLASRNPTFMGLALHCIANVGSREMAEAFAGEIPK
ILVAGDTMDSVKQSAALCLLRLYRTSPDLVPMGDWTSRVVHLLNDQHLTQGLVGLLFSMV
TLLGWRDSSESKGNVSLPGPYRVDFFMRSVVSEGQQFCWLQMPCACASVCSVFRRALCSS
LAGRLTAWLSDVLNGRQFPPGGLRCRQRSLAMWLHMPNTLSGSCTCRLGERLTAMQKDRR
GVFFQLSAVALGQCVGSIEPSGTHGATSLNLLGSPENVVEASCTPKLWHVRRSFRSPGVD
MGQHAVGPRAPPLSSRPLQVLKVAILAEKYAVDYTWYVDTILNLIRIAGDYVSEEVWYRV
IQIVINRDDVQGYAAKTVFEALQAPACHENLVKVGGYILGEFGNLIAGDPRSSPLIQFNL
LHSKFHLCSVPTRALLLSTYIKFVNLFPEVKATIQDVLRSDSQLRNADVELQQRAVEYLR
LSTVASTDILATVLEEMPPFPERESSILAKLKKKKGPNTVTDLEEAKRERSADVNGGPEP
APASAATAVPTGFLVDRRGAPAPAGPPPSSGGLLVDVFSDSPSAVAPLAPGSEDNFASLS
VAPPPSPASPVFPASSGHPAPLCMEPCLLFVCKNNGVLFENQLLQIGLKSEFRQNLGRMF
IFYGNKTSTQFLSFTPTLICSDDLQTNILLQTKPVDPTVDGGAQVQQVVNIECVSDFTEA
PVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSSPQQEVQNIFKAKH
PMDTEITKAKIIGFGSALLEDVDPNPANFVGAGIIHTRTTQIGCLLRLEPNLQAQMYRLT
LRTSKEAVSRRLCALLSEQF
Download sequence
Identical sequences M3YD34
ENSMPUP00000009241 ENSMPUP00000009241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]