SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009257 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009257
Domain Number 1 Region: 137-337
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.15e-46
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.032
Further Details:      
 
Domain Number 2 Region: 23-111
Classification Level Classification E-value
Superfamily WWE domain 3.01e-17
Family WWE domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009257   Gene: ENSMPUG00000009332   Transcript: ENSMPUT00000009411
Sequence length 338
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897169.1:818744:859765:1 gene:ENSMPUG00000009332 transcript:ENSMPUT00000009411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEANPEMFHKAEEFLPKRTDSEMDEMDTSDTQWGWFYLAECGKWHMFQPDTNIQCSVSS
EDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLITGKQRLIKRAPFSISAFSYICEN
EAIPMPPHWENVNTDVPYQLVPLHSQTHEYNEVASLFGKTMDRGRIKRIQRIQNLDLWEF
FCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGALFGKGTYFARD
AIYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSK
DGSYVNLYDSCVDDTWDPKIFVVFDANQIYPEYLIDFY
Download sequence
Identical sequences M3YD50
ENSMPUP00000009257 ENSMPUP00000009257 XP_004416031.1.74151 XP_004778340.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]