SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009347 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009347
Domain Number 1 Region: 1630-1754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000437
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 
Domain Number 2 Region: 1197-1353
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000409
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Domain Number 3 Region: 790-910
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000115
Family PLC-like (P variant) 0.044
Further Details:      
 
Domain Number 4 Region: 1428-1554
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000146
Family Synaptotagmin-like (S variant) 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009347
Domain Number - Region: 616-699
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00811
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009347   Gene: ENSMPUG00000009422   Transcript: ENSMPUT00000009501
Sequence length 2334
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897030.1:2558196:2704881:1 gene:ENSMPUG00000009422 transcript:ENSMPUT00000009501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQRKGQGPVGVRGRKKRGLSDISPSTSLPPLVEGQLRCFLKLTVNKVIWKIAKPPTCVL
VRVRWWGETSDGTLFCPRDALQTEPKSVRTTTRYAVRCGPKQFTSYLTDMAVLVLEVITK
IDHLPIGRVQISGLAQLSPTHHISGFFTIVSPTSKKLGELQVSLALEPLSETYDSYNPLP
STNVKENVLLSEQEFREYTEPSSSQFLVPSRPHRMPTTKIDGQELAANSSRSTTPRGKDH
LYFTENSDTIKDSFFGLQHHLNSGRSLESMTLKGKAPRKQMSLLNSSEFQPQIRTVARSH
SDSCILSSNNPPTKDLLSALLEQGDKLRNAMVISTMKSSPDTSMLLDEVHPPMKEDFLKA
STQIKALSRDQFKDHITDHLLPPTENTFWKHDTKDDTRAIQLLLGSAELSQGRYWNGLGS
PPDSLSPGSDVDCSSELNDPQYDQSLLESLFYTAPKSDTSISDFFSEDDIVASKKMNQSK
ALAKSPKLVESSDPKLKKRAAGKKNRNLVEQQMISETPEDAQVMTLSVDRLALLGRTHSV
RIIIETMIVPPDSPQMTPGKKSFSGRPLKLTAIKKRTFFVEYHFPVGFSKNGLGKTALIT
EVVRLASSKITDGMVNFQQRFVFPVHFGGPMIEHWWNSNLTFQIYTKKTPQKKPEVIGSA
SLPLRTVIQSELLSFSNQLPVQQENGQTPLGPLKVTIELVIDNKDFTGVNTKLSSSTQHN
PPCALTSPNKTLSEPGQYVTCTKNPENLNQIHKEAAKKVQNLVLPKPKSPSPVISNPSTF
MNVPASHNLANQTNGSTKETSLLLHVLLMVPDGKDFITGESDKQPPCNVYLNCKLFSTEE
VTRSVIAWGTTQPVFNFLQVIPVSLSSKYLERLKNNVMVIEAWNKLRSPGQDKLLGLVKL
PLHQFYMSFKDPKISRLLLDAQYPVVAVDSYMPVIDVFSGHQNGSLRVFLAMGSSDQIMA
LQRLKNEEGTLPPFSPRPAHFLDQPSTASVNMEDQRSGLMEHHFELHVEKVKGLAPLQAT
VWGEADCYVQYYFPVQDSQSSVLKGSEFPENGISLKPFRSATTLCVPDPIFNSEHHHSLL
LPSEVPVQRLLLSAFSAQGLVPGGGVQFEIWCRYYYPNVRDQVVAKGTLPLSRICAMVTM
QHREDVGIQTFNLPLTPRLENRKELRNQSSGLLDVGLRYRRTPRTAEGVLAARAVSISVQ
VIRACGLQAAAKALAEQEPALQFSATVGVNAFVTTHLSFLPKGEQRRTRPIACSFCPEFS
HHIEFPCNLVTQHCSGEACFLAELLEFAEVTFAVYHEDTKSASDITSIQSFRDYLLGVVK
IPTKELLVKRSGITGWYPIILPEDGALPHGLELMQKIVGGLELSVSFTHPGDRERVLEAA
ELLGWNFENNLKNLVKMNEDEPASVTISTPRLWLPIHCVLLAGQSHIHKNTYCYLRYKLY
DHEAFWTPLKKPKESTNKKQVMVTFKASRRAEVTRGPSLLWYFREERLEIQVWRAYGNDS
LERPHQTDSWIGSAYVDLARLGERSARTLTVSGVYPLFGRNASNLAGAALRVHVVLSSPS
PHPGPAPELDSVDCSSHSESEQFPRRNDEIPLSPSPAHQKSPASTHVPCNTTKEVSPAEE
SPATLDGTFAVSILVERAMHLSLKGSPLTERKVLIPSCCVSFATADDPSPIYTHVVENTD
SPIWNFQQQSRLSKELLLDPQQTLVFKVWHKGDEERVIGFASVDLSPLLSGFQFVCGWYN
ITDFSGECQGQIKVAVSPLESLMHFKEEKQSRRGVETPGLLNPVYRPFSFPASAFLSSIA
RWTPEQFAHTSSKELDFSSPERSSTTRSQASRHEEHVQNIRRFHESLQQGEAVLPRDDKL
TTLPLSSRTSILTSLRRNLNELDQIQQYFSQKLSKPLLPLSPQSYSILQCQESHRDHRGP
GDSSLDPESQSILEKSNNLVLQVSSLITDLQTITKNTQASLSSHRARSRSGEVPTLPDGQ
ETVVMEERSTTPELPLARAPDGGRSPLTRPTLEETSSGRGILHESLGHTVPITRMQSSEE
TEAGQAYSDEEYEEDIIEPRTLNDITTVTDKTSPWSSFMSDTSEVNEVHREGPSCSSSKH
FPRDELKGKSSPLSSPGRVVQPHLLGQGSSSQSLTACEGESSHSRDGESASAVPHLVSQV
TVSEAQQSNTSVGLSSPRANQDQEGRLEAQTENEAASSELSDSADSFKKFPLHLASRSRK
ESHRGLPINCSEIRQNQATSGTEVSTRQSLLPEPIVVPNFFLPPQQLEASMRMLSLSAAM
PPPAATDQDKSEASSRVLSRRPCRPRPNSLPPNLPEEETRRIARIFSSQYSQKD
Download sequence
Identical sequences M3YDE0
ENSMPUP00000009347 ENSMPUP00000009347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]