SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009434 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009434
Domain Number 1 Region: 84-249
Classification Level Classification E-value
Superfamily RUN domain-like 8.63e-54
Family RUN domain 0.000000026
Further Details:      
 
Domain Number 2 Region: 548-629
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000672
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000009434
Domain Number - Region: 289-336
Classification Level Classification E-value
Superfamily Prefoldin 0.00165
Family Prefoldin 0.016
Further Details:      
 
Domain Number - Region: 296-518
Classification Level Classification E-value
Superfamily Tropomyosin 0.0451
Family Tropomyosin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009434   Gene: ENSMPUG00000009510   Transcript: ENSMPUT00000009589
Sequence length 638
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897018.1:5485777:5554802:-1 gene:ENSMPUG00000009510 transcript:ENSMPUT00000009589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
SWEDLTDLVEQMRDDTEDPNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQ
QFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASVKDLPGLKTPVGR
GRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANF
CMKGEDLDSQVGVIDFSMYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNLQ
AKVDALEKSNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQAL
SEARKHLKEETQLRLDVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLR
ALKHELAFKLQSSDLGVKQKSELNSRLEEKTNQMAATIKQLEQRLRQAERGRQSAESDNR
LFKQDFGEKINSLQMQVDQLTRQRHQLELELKLERERRLQNDRSIPGKGPQKPQPKMDGK
HKIQEENVKPKEALDESHRLPSPPEDEQNQLLLSEKPQTCQLCREGSGRTKNVCKNCRGT
FCNACSTNELPLPSSIKPERVCNPCHEHLMKQYSTSPS
Download sequence
Identical sequences M3YDM7
XP_012918868.1.14098 ENSMPUP00000009434 ENSMPUP00000009434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]