SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009435 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009435
Domain Number 1 Region: 143-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.69e-123
Family Transglutaminase core 0.000000000058
Further Details:      
 
Domain Number 2 Region: 3-141
Classification Level Classification E-value
Superfamily E set domains 2.73e-44
Family Transglutaminase N-terminal domain 0.00000761
Further Details:      
 
Domain Number 3 Region: 483-595
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.73e-30
Family Transglutaminase, two C-terminal domains 0.00000212
Further Details:      
 
Domain Number 4 Region: 595-693
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-26
Family Transglutaminase, two C-terminal domains 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009435   Gene: ENSMPUG00000009511   Transcript: ENSMPUT00000009590
Sequence length 694
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897073.1:3857639:3899403:-1 gene:ENSMPUG00000009511 transcript:ENSMPUT00000009590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALEPQNVNWQETSNRRAHHTDRFSSRELILRRGQPFSFSLNLNRSLGDGESLAFITST
GPYPSESARTKAVFPLSSGTSHGGWSAQLVSKQDNILTISISSPANAPIGWYTLNTQISS
QGKDFVLKLGTFILLFNPWLPEDGVFMSNHAEREEYVQEDAGIIYVGSTNRIGMVGWNFG
QFEDGILNICLSILDHSLNFRRDPATDVARRNDPKYVGRVLSAMVNGNDDNGVISGNWSG
NYTGGLDPRNWNGSVEILKEWKKSGFRPVRYGQCWVFAGTLNTVLRCFGIPSRVVTNFNS
AHDTDRNLSVDVYYDPYGRPIEKGSDSVWNFHVWNEGWFVRTDLGPSYNGWQVLDATPQE
RSQGVFQCGPASVVAVREGDVNLDFDMPFVFAEVNADRITWIYDAYNSTQKQNASDTHSI
GRYISTKAVGSNSRMDITEKYKYPEGSSQERQVFEKALGKLKPHASFGATSARPLAREER
EPSISGKFKVIGILEVGKEVNLALLLKNLTSDMKTVTVNMTAWTIVYNGTLVHEVWKDSV
TISLDPKEEIQHPVKITYAQYEKYLKADNMIRTTAVCQVPDEAEVLVERDIILDNPSLTL
EVLDQARVRKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLRIDVPTLRPKERSRVRF
EILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences M3YDM8
ENSMPUP00000009435 XP_004772977.1.14098 ENSMPUP00000009435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]