SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009449 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009449
Domain Number 1 Region: 543-705
Classification Level Classification E-value
Superfamily Sec7 domain 7.2e-53
Family Sec7 domain 0.0000513
Further Details:      
 
Domain Number 2 Region: 742-879
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-24
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009449   Gene: ENSMPUG00000009525   Transcript: ENSMPUT00000009604
Sequence length 1020
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896905.1:27663004:27680284:-1 gene:ENSMPUG00000009525 transcript:ENSMPUT00000009604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGDDRLSEHPKPMEFLNLYLGDNLQTGPGAHPRDTCSLPDPPEPHGEQTWALEPPSSMK
PDAPPGGSSMEPLHLGSSSSQEEPRHKVAPPESPGNNHPLGSPRQSQSTSTQVVFWAGIL
QAQMCVLDLEEELEKTEGLRAELRCCLPTAPVELPAFPSSPAGPQGSGLHPSSPVDDSPV
DEVPGGDSSGTEGENQHSLWPREGRTDSSPEWGAEEESLFFDNPLFLESPCSDSASGARL
SWGLSDSCMDGGPKPECPQILEPPLPGGGVLWELDSELDLGAGTADSSGHTTPPFPVPTY
KPHSFSWPVVNEATKGTPEAPPDCGETETSLGDSLGPAPSAASGVETGQVGSDPSSARHL
VQPWALPSPEGWQTEEGPSWPGVPLISQDQGDSDAECPQESALRTLAPGPWGSPASSPEP
SSPESESRGPGPRPSPVSSREGSPSPLGPNWLSSLPERTLDASCPSLLETDGAEPSFPEK
EEAGEPPQPGEEVKSEGPAGTAKAGAVQPGVCLTSAAGLPESPMPQAQCPEEGQRPQTGD
KLANGVNSDKVAWNLASRLYHLEGFRKSEVAAYLQKNNDFSRAVAEEYLSFFQFGGQSLD
RALRGFLQALVLSGETQERERILYQFSKRFHYCNPGAFPSADSVHTLTCAIMLLNTDLHG
QNIGKSMSCQEFITNLNGLQDGGNFPKELLKALYWSIRSEKLEWAMDEEDAGRPEKAQVS
PPTGKLSNPFLQLAQNPTAPTYKQGILARKMHHDADGKKTPWGKRGWKMFHTLLRGMVLY
FLKGEDHCPPAGESLVGQMVDEPVGVHHSLATPATHYTKKPHVFQLRTADWRLYLFQAPT
AKEMSSWIVRINLAAATHSAPPFPAAVGSQRRFVRPILPIGPAQSSLEEQHRSHENCLDA
ASDDLLDLQRNLPERRGRGRELEEYRLRKEYLEYEKTRYETYVQLLVARLHCPSDDLDLW
EEQLGKEARGAQEPKPSLKKSHSSPSLHQEEAPTTAKVKRNISERRTYRKIIPKRNRNQL
Download sequence
Identical sequences M3YDP2
ENSMPUP00000009449 XP_004742453.2.14098 XP_004742454.2.14098 XP_004742455.1.14098 XP_012906692.1.14098 XP_012906693.1.14098 ENSMPUP00000009449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]