SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009473 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009473
Domain Number 1 Region: 271-802
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.11e-159
Family Lysophospholipase 0.000000102
Further Details:      
 
Domain Number 2 Region: 11-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.7e-24
Family PLC-like (P variant) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009473   Gene: ENSMPUG00000009550   Transcript: ENSMPUT00000009629
Sequence length 810
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:8718555:8781370:-1 gene:ENSMPUG00000009550 transcript:ENSMPUT00000009629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWGAQGGLSPCHMLTVKVIRMRNVRQADRVSQTDCFVSLWLPTASRERLRTRTISNCP
NPEWNETFSFQIQSQVKNVLELSVCDEDTLTPDDHLLTILYDLTKLCFRKKTHVKFPLNP
EGMEELEVEFLLEESSSPPEILITNGVLVSRQVSRLEVHAECRRQKKRRKMKDLLVTVKE
SFEHTQRVPCRQEPCCPNPACFHYPKYFQPCMHVDVPTSQWSHGLCCCCAHSKNSPVRQP
LDCLSDGQTVTLPVGEDCELHMKSTPCPQTLDVRLGFSLCPEEQEFLEKRRVVVAEALQQ
VLQLEEDLSADEVPLIAIMATGGGTRSMTAMYGHLLGLQKLNILNCASYITGLSGATWTM
ATLYRDPDWSSKNLEPAILEARRHVVKDKMPALFPDQLAKFQEELRLRSQEGYKVTFTDF
WGLLIEACLGDERNESKLSDQRAALCQGQNPLPIYLTINVKDDVSNQDFREWCEFSPYEV
GLQKYGAFIPTELFGSEFFMGRLMKRLPESRMCYMLGLWSSIFSLNLLDAWNLSQSSEEF
FHRWTREKVNDIEDEPLLPEIPKCDATVLDTSVVIPGSWLSNTFRSILTHRAFVSQFHNF
LRGLQLHTDYLQNNQFSMWKDTVLDGFPNQLTESVNHLCLLDTAFFVNSSYPPLLRPERK
VDLIIHLNYCAGSQTKPMKQTCEYCSVQNIPFPKYELREDEENLKECYLMENSQEPDAPI
VLFFPLINDTFQKYKAPGVERSPEELEQGHVDIYGPKTPYATKELTYTEAAFDKLVKLSE
YNILNNKDKLLQALRLAVEKKKRLKSQCPS
Download sequence
Identical sequences M3YDR6
ENSMPUP00000009473 XP_004751232.1.14098 ENSMPUP00000009473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]