SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009487 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000009487
Domain Number - Region: 99-195
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0883
Family DBL homology domain (DH-domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009487   Gene: ENSMPUG00000009564   Transcript: ENSMPUT00000009643
Sequence length 338
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896939.1:6705218:6910579:-1 gene:ENSMPUG00000009564 transcript:ENSMPUT00000009643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDETLVEFIKRTIMKIPITEMMPILKAWDFLSEKQLQTVNFRQRKESLVQDLVLLCEERR
ASIHDAALLDIIYTQFHRHQKVWDVFQMSKEPGEDIDLFDMEQFKSSFVKILQRALKNVT
VSFRDAEENAVWIRIAWGTQYRKPNQYKPVYVVYYSQTPYAFTSFCPLKSNMPLLGQALT
VASNHHKIVKMDLRSRYLDSLKAIVFKQYNRTFETHNSTVPLQDRTLELDIHMDSRIIHE
NRIEKERVQRVTQETFGDYPQPRLEFAQYKLETKFKSELNGDILAERKEPLRCLIKFSSP
HLLEALKALAPAGLAGQAGLSGNTQSPCVRRAATPSLV
Download sequence
Identical sequences M3YDT0
ENSMPUP00000009487 ENSMPUP00000009487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]