SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000009493 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000009493
Domain Number 1 Region: 288-816
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 6.02e-152
Family Lysophospholipase 0.000000338
Further Details:      
 
Domain Number 2 Region: 30-147
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-27
Family PLC-like (P variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000009493   Gene: ENSMPUG00000009570   Transcript: ENSMPUT00000009649
Sequence length 829
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896926.1:8799730:8822717:-1 gene:ENSMPUG00000009570 transcript:ENSMPUT00000009649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWSGARRVGMERLTTRGPPDHPHQGEASACWRLTVRVLEARNLGWTDLLSEADPYVTLEL
PTVPGTKFKTKTITNSCHPVWNETFSFLIQNQVKNVLELNVYDEDSVTEDDACFKVLYDI
SEVLPGQLLRKTFSLRPQGQEELDVEFKLEKTSDSPENLITNNVLVARELSCLDVCLDRA
GSTTTVTDQDKLELELVLKGSYEDTQTSVLGPASAFCFHYMAAQEGKLSARVRSSSSNSW
SSDESAGHLTVPLRSLAVGKEVTFHVPTTNTPGVRLQLKTEGCPKELDVHLGFDLCAEEK
AFLSRRKQVVAKALKHILQLDRDLQEDEVPIVGIMATGGGARAMTALYGHLLALQKLGLL
DCVAYISGISGSTWTMAHLYGDPEWSQKDLEGPIKYAREHLVKSKMEVFSPERLTSYHQE
LELRAQQGYPTTFVDLWALVLESMLHNQVMDQKLSEQKTGLEQGQNPLPLYLSLNVKENN
LETFDFKEWVEFSPYEVGFLKYGAFVPSELFGSEFFMGQLMRKLPESRICFLEGIWSNIL
SLNLLDVWYDLLSSEDTRKQHLKDKIRNLGKNPEESPASLKTSWLEASWLQPGTALAKAF
KGLLTGRPFHQHSCNFLRGLQLHQNYYSQKDFSTWADCPLDSTASQLTPQEPQLCLVDAG
YFLNTSCPSMFRPGRRLDLILSFDYSLPSSFEALQQTEAYCRARGLPFPWVEPSPQDQHQ
PPECHLFSDPSCPDAPLLLHFPLVNASFRDHSAPGVQRSPAELPAGQVDLTGTNSPYSLF
NMTYKEEDFDRLLQLSDYNVRNSQGAILQALRTAMKHRALGARPRAAQN
Download sequence
Identical sequences M3YDT6
ENSMPUP00000009493 ENSMPUP00000009493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]